Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 289460..290259 | Replicon | chromosome |
| Accession | NZ_CP102679 | ||
| Organism | Escherichia coli strain XH989 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | F4VJD3 |
| Locus tag | NU949_RS03540 | Protein ID | WP_000347266.1 |
| Coordinates | 289460..289924 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | NU949_RS03545 | Protein ID | WP_001307405.1 |
| Coordinates | 289924..290259 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NU949_RS03510 (284461) | 284461..284895 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| NU949_RS03515 (284913) | 284913..285791 | - | 879 | WP_001315856.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NU949_RS03520 (285781) | 285781..286560 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NU949_RS03525 (286571) | 286571..287044 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NU949_RS03530 (287067) | 287067..288347 | - | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NU949_RS03535 (288596) | 288596..289405 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| NU949_RS03540 (289460) | 289460..289924 | - | 465 | WP_000347266.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NU949_RS03545 (289924) | 289924..290259 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NU949_RS03550 (290408) | 290408..291979 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
| NU949_RS03555 (292354) | 292354..293688 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| NU949_RS03560 (293704) | 293704..294474 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17841.18 Da Isoelectric Point: 9.4947
>T253971 WP_000347266.1 NZ_CP102679:c289924-289460 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A836NGD2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |