Detailed information of TA system TA253966

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 160890..161316
• Replicon: plasmid pXH989-CTX
• Accession: NZ_CP102676
• Organism: Escherichia coli strain XH989

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NU949_RS00980
• Protein ID: WP_001372321.1
• Coordinates: 160890..161015 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	161092..161316 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NU949_RS00940 (156264)	156264..156953	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
NU949_RS00945 (157140)	157140..157523	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NU949_RS00950 (157844)	157844..158446	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
NU949_RS00955 (158743)	158743..159564	-	822	WP_001234426.1	DUF932 domain-containing protein	-
NU949_RS00960 (159682)	159682..159969	-	288	WP_000107535.1	hypothetical protein	-
NU949_RS00965 (159994)	159994..160200	-	207	WP_000547968.1	hypothetical protein	-
NU949_RS00970 (160270)	160270..160442	+	173	Protein_193	hypothetical protein	-
NU949_RS00975 (160440)	160440..160670	-	231	WP_071586998.1	hypothetical protein	-
NU949_RS00980 (160890)	160890..161015	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NU949_RS00985 (160957)	160957..161106	-	150	Protein_196	plasmid maintenance protein Mok	-
- (161092)	161092..161316	-	225	NuclAT_0	-	Antitoxin
- (161092)	161092..161316	-	225	NuclAT_0	-	Antitoxin
- (161092)	161092..161316	-	225	NuclAT_0	-	Antitoxin
- (161092)	161092..161316	-	225	NuclAT_0	-	Antitoxin
NU949_RS00990 (161128)	161128..161316	+	189	WP_001299721.1	hypothetical protein	-
NU949_RS00995 (161285)	161285..162047	-	763	Protein_198	plasmid SOS inhibition protein A	-
NU949_RS01000 (162044)	162044..162478	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
NU949_RS01005 (162533)	162533..162730	-	198	Protein_200	hypothetical protein	-
NU949_RS01010 (162758)	162758..162991	-	234	WP_000005987.1	DUF905 family protein	-
NU949_RS01015 (163059)	163059..163598	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
NU949_RS01020 (163624)	163624..163830	-	207	WP_000275856.1	hypothetical protein	-
NU949_RS01025 (163900)	163900..163980	+	81	Protein_204	hypothetical protein	-
NU949_RS01030 (164163)	164163..164332	-	170	Protein_205	hypothetical protein	-
NU949_RS01035 (164969)	164969..165940	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B / rmtB / aac(3)-IId / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / fosA3 / blaCTX-M-65 / sitABCD	iroN / iroE / iroD / iroC / iroB / iutA / iucD / iucC / iucB / iucA	1..188009	188009

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T253966 WP_001372321.1 NZ_CP102676:c161015-160890 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT253966 NZ_CP102676:c161316-161092 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin