Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3384616..3385415 | Replicon | chromosome |
Accession | NZ_CP102675 | ||
Organism | Escherichia coli strain XH987 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | F4VJD3 |
Locus tag | NU950_RS18445 | Protein ID | WP_000347266.1 |
Coordinates | 3384616..3385080 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | NU950_RS18450 | Protein ID | WP_001307405.1 |
Coordinates | 3385080..3385415 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NU950_RS18415 (3379617) | 3379617..3380051 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
NU950_RS18420 (3380069) | 3380069..3380947 | - | 879 | WP_001315856.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NU950_RS18425 (3380937) | 3380937..3381716 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NU950_RS18430 (3381727) | 3381727..3382200 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NU950_RS18435 (3382223) | 3382223..3383503 | - | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NU950_RS18440 (3383752) | 3383752..3384561 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NU950_RS18445 (3384616) | 3384616..3385080 | - | 465 | WP_000347266.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NU950_RS18450 (3385080) | 3385080..3385415 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NU950_RS18455 (3385564) | 3385564..3387135 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
NU950_RS18460 (3387510) | 3387510..3388844 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
NU950_RS18465 (3388860) | 3388860..3389630 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17841.18 Da Isoelectric Point: 9.4947
>T253949 WP_000347266.1 NZ_CP102675:c3385080-3384616 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A836NGD2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |