Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 2589738..2590340 | Replicon | chromosome |
Accession | NZ_CP102675 | ||
Organism | Escherichia coli strain XH987 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | NU950_RS14560 | Protein ID | WP_000897305.1 |
Coordinates | 2590029..2590340 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NU950_RS14555 | Protein ID | WP_000356397.1 |
Coordinates | 2589738..2590028 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NU950_RS14530 (2585683) | 2585683..2586585 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
NU950_RS14535 (2586582) | 2586582..2587217 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
NU950_RS14540 (2587214) | 2587214..2588143 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
NU950_RS14545 (2588473) | 2588473..2588715 | - | 243 | WP_001087409.1 | protein YiiF | - |
NU950_RS14550 (2588934) | 2588934..2589152 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
NU950_RS14555 (2589738) | 2589738..2590028 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
NU950_RS14560 (2590029) | 2590029..2590340 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
NU950_RS14565 (2590569) | 2590569..2591477 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
NU950_RS14570 (2591541) | 2591541..2592482 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
NU950_RS14575 (2592527) | 2592527..2592964 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
NU950_RS14580 (2592961) | 2592961..2593833 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
NU950_RS14585 (2593827) | 2593827..2594426 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2588473..2597993 | 9520 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T253947 WP_000897305.1 NZ_CP102675:c2590340-2590029 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|