Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 100158..100412 | Replicon | plasmid pXH987-CTX |
| Accession | NZ_CP102673 | ||
| Organism | Escherichia coli strain XH987 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NU950_RS00940 | Protein ID | WP_001312851.1 |
| Coordinates | 100263..100412 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 100158..100219 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NU950_RS00915 (96906) | 96906..97652 | + | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
| NU950_RS00920 (97711) | 97711..98571 | + | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| NU950_RS00925 (98674) | 98674..99234 | + | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| NU950_RS00930 (99370) | 99370..99582 | + | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| NU950_RS00935 (99828) | 99828..99902 | + | 75 | Protein_112 | endonuclease | - |
| - (100158) | 100158..100219 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (100158) | 100158..100219 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (100158) | 100158..100219 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (100158) | 100158..100219 | - | 62 | NuclAT_1 | - | Antitoxin |
| NU950_RS00940 (100263) | 100263..100412 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NU950_RS00945 (100696) | 100696..100953 | + | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| NU950_RS00950 (100970) | 100970..101221 | - | 252 | WP_223195197.1 | replication protein RepA | - |
| NU950_RS00955 (101212) | 101212..101259 | + | 48 | WP_229471593.1 | hypothetical protein | - |
| NU950_RS00960 (101252) | 101252..101734 | + | 483 | WP_001273588.1 | hypothetical protein | - |
| NU950_RS00965 (101727) | 101727..102584 | + | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| NU950_RS00970 (103285) | 103285..103425 | + | 141 | WP_001333237.1 | hypothetical protein | - |
| NU950_RS00975 (103523) | 103523..104005 | + | 483 | WP_228252671.1 | histidine phosphatase family protein | - |
| NU950_RS00980 (103987) | 103987..104178 | + | 192 | WP_001376180.1 | CPBP family glutamic-type intramembrane protease | - |
| NU950_RS00985 (104271) | 104271..104528 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| NU950_RS00990 (104461) | 104461..104862 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | rmtB / blaTEM-1B / sitABCD / blaCTX-M-65 / fosA3 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / aac(3)-IId | iroB / iroC / iroD / iroE / iroN / iucA / iucB / iucC / iucD / iutA | 1..167177 | 167177 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T253934 WP_001312851.1 NZ_CP102673:100263-100412 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT253934 NZ_CP102673:c100219-100158 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|