Detailed information of TA system TA253930

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 61657..62083
• Replicon: plasmid pXH987-CTX
• Accession: NZ_CP102673
• Organism: Escherichia coli strain XH987

Toxin (Protein)

• Gene name: hok
• Uniprot ID: G9G195
• Locus tag: NU950_RS00705
• Protein ID: WP_001323520.1
• Coordinates: 61967..62083 (+)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	61657..61881 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NU950_RS00650 (57033)	57033..58004	+	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-
NU950_RS00655 (58641)	58641..58810	+	170	Protein_56	hypothetical protein	-
NU950_RS00660 (58993)	58993..59073	-	81	Protein_57	hypothetical protein	-
NU950_RS00665 (59143)	59143..59349	+	207	WP_000275856.1	hypothetical protein	-
NU950_RS00670 (59375)	59375..59914	+	540	WP_000290840.1	single-stranded DNA-binding protein	-
NU950_RS00675 (59982)	59982..60215	+	234	WP_000005987.1	DUF905 family protein	-
NU950_RS00680 (60243)	60243..60440	+	198	Protein_61	hypothetical protein	-
NU950_RS00685 (60495)	60495..60929	+	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
NU950_RS00690 (60926)	60926..61688	+	763	Protein_63	plasmid SOS inhibition protein A	-
NU950_RS00695 (61657)	61657..61845	-	189	WP_001299721.1	hypothetical protein	-
- (61657)	61657..61881	+	225	NuclAT_0	-	Antitoxin
- (61657)	61657..61881	+	225	NuclAT_0	-	Antitoxin
- (61657)	61657..61881	+	225	NuclAT_0	-	Antitoxin
- (61657)	61657..61881	+	225	NuclAT_0	-	Antitoxin
NU950_RS00700 (61867)	61867..62016	+	150	Protein_65	plasmid maintenance protein Mok	-
NU950_RS00705 (61967)	61967..62083	+	117	WP_001323520.1	type I toxin-antitoxin system Hok family toxin	Toxin
NU950_RS00710 (62303)	62303..62533	+	231	WP_071586998.1	hypothetical protein	-
NU950_RS00715 (62531)	62531..62703	-	173	Protein_68	hypothetical protein	-
NU950_RS00720 (62773)	62773..62979	+	207	WP_000547968.1	hypothetical protein	-
NU950_RS00725 (63004)	63004..63291	+	288	WP_000107535.1	hypothetical protein	-
NU950_RS00730 (63409)	63409..64230	+	822	WP_001234426.1	DUF932 domain-containing protein	-
NU950_RS00735 (64527)	64527..65129	-	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
NU950_RS00740 (65450)	65450..65833	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NU950_RS00745 (66020)	66020..66709	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	rmtB / blaTEM-1B / sitABCD / blaCTX-M-65 / fosA3 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / aac(3)-IId	iroB / iroC / iroD / iroE / iroN / iucA / iucB / iucC / iucD / iutA	1..167177	167177

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (1-34)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4455.23 Da
• Isoelectric Point: 8.5110

>T253930 WP_001323520.1 NZ_CP102673:61967-62083 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 117 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT253930 NZ_CP102673:61657-61881 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Toxin

• AlphaFold DB: G9G195

Antitoxin