Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4765907..4766661 | Replicon | chromosome |
| Accession | NZ_CP102669 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain ATCC 14028 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | NUW86_RS23355 | Protein ID | WP_000558166.1 |
| Coordinates | 4765907..4766218 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NUW86_RS23360 | Protein ID | WP_001259011.1 |
| Coordinates | 4766215..4766661 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUW86_RS23325 (4761565) | 4761565..4762467 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| NUW86_RS23330 (4762464) | 4762464..4763099 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NUW86_RS23335 (4763096) | 4763096..4764025 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NUW86_RS23340 (4764072) | 4764072..4764362 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| NUW86_RS23345 (4764363) | 4764363..4764674 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| NUW86_RS23350 (4764892) | 4764892..4765821 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| NUW86_RS23355 (4765907) | 4765907..4766218 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NUW86_RS23360 (4766215) | 4766215..4766661 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NUW86_RS23365 (4766676) | 4766676..4767617 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NUW86_RS23370 (4767662) | 4767662..4768099 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| NUW86_RS23375 (4768096) | 4768096..4768968 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| NUW86_RS23380 (4768962) | 4768962..4769561 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| NUW86_RS23385 (4769752) | 4769752..4770555 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NUW86_RS23390 (4770589) | 4770589..4771485 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T253925 WP_000558166.1 NZ_CP102669:4765907-4766218 [Salmonella enterica subsp. enterica serovar Typhimurium]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT253925 WP_001259011.1 NZ_CP102669:4766215-4766661 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|