Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2512563..2513085 | Replicon | chromosome |
Accession | NZ_CP102669 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain ATCC 14028 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | NUW86_RS12450 | Protein ID | WP_000221343.1 |
Coordinates | 2512801..2513085 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NUW86_RS12445 | Protein ID | WP_000885424.1 |
Coordinates | 2512563..2512811 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUW86_RS12420 (2507779) | 2507779..2509245 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
NUW86_RS12425 (2510053) | 2510053..2510767 | + | 715 | Protein_2431 | helix-turn-helix domain-containing protein | - |
NUW86_RS12430 (2510823) | 2510823..2511731 | - | 909 | WP_010989018.1 | hypothetical protein | - |
NUW86_RS12435 (2511874) | 2511874..2512206 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
NUW86_RS12440 (2512196) | 2512196..2512411 | - | 216 | WP_000206207.1 | hypothetical protein | - |
NUW86_RS12445 (2512563) | 2512563..2512811 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NUW86_RS12450 (2512801) | 2512801..2513085 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NUW86_RS12455 (2513256) | 2513256..2513645 | + | 390 | WP_000194089.1 | RidA family protein | - |
NUW86_RS12460 (2513697) | 2513697..2514776 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NUW86_RS12465 (2514969) | 2514969..2515457 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NUW86_RS12470 (2515502) | 2515502..2517010 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2507782..2519867 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T253917 WP_000221343.1 NZ_CP102669:2512801-2513085 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |