Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 911100..911754 | Replicon | plasmid pSOD02 |
| Accession | NZ_CP102605 | ||
| Organism | Pantoea sp. SOD02 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NR302_RS23620 | Protein ID | WP_258145884.1 |
| Coordinates | 911425..911754 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NR302_RS23615 | Protein ID | WP_258145522.1 |
| Coordinates | 911100..911396 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NR302_RS23575 (NR302_23575) | 906128..906859 | + | 732 | WP_154182668.1 | SDR family oxidoreductase | - |
| NR302_RS23580 (NR302_23580) | 906904..907590 | - | 687 | WP_258145521.1 | DJ-1/PfpI family protein | - |
| NR302_RS23585 (NR302_23585) | 907642..908610 | - | 969 | WP_081113251.1 | magnesium/cobalt transporter CorA | - |
| NR302_RS23590 (NR302_23590) | 908654..909124 | - | 471 | WP_008109208.1 | GNAT family N-acetyltransferase | - |
| NR302_RS23595 (NR302_23595) | 909193..909435 | + | 243 | WP_258145883.1 | GNAT family N-acetyltransferase | - |
| NR302_RS23600 (NR302_23600) | 909417..909737 | - | 321 | WP_008109204.1 | AzlD domain-containing protein | - |
| NR302_RS23605 (NR302_23605) | 909727..910401 | - | 675 | WP_008109202.1 | AzlC family ABC transporter permease | - |
| NR302_RS23610 (NR302_23610) | 910504..911052 | + | 549 | WP_061719009.1 | XRE family transcriptional regulator | - |
| NR302_RS23615 (NR302_23615) | 911100..911396 | - | 297 | WP_258145522.1 | NadS family protein | Antitoxin |
| NR302_RS23620 (NR302_23620) | 911425..911754 | - | 330 | WP_258145884.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NR302_RS23625 (NR302_23625) | 911951..912472 | + | 522 | WP_154156629.1 | GNAT family N-acetyltransferase | - |
| NR302_RS23630 (NR302_23630) | 912469..913872 | - | 1404 | WP_258145523.1 | ATP-binding cassette domain-containing protein | - |
| NR302_RS23635 (NR302_23635) | 913869..914654 | - | 786 | WP_258145524.1 | ABC transporter permease subunit | - |
| NR302_RS23640 (NR302_23640) | 914651..915586 | - | 936 | WP_258145885.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | hcp/tssD / exeG | 1..926844 | 926844 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12802.77 Da Isoelectric Point: 8.4675
>T253892 WP_258145884.1 NZ_CP102605:c911754-911425 [Pantoea sp. SOD02]
ISYLEFIETRVFSKARKVLLEDDDEFNELQCYLLDHHDLGDTIRDTGGCKKIRWSRSGMGKQGGTRIIYFTRLLSGRIYL
LLIYPKNVKDDLNENEKAMLKVFTRQINL
ISYLEFIETRVFSKARKVLLEDDDEFNELQCYLLDHHDLGDTIRDTGGCKKIRWSRSGMGKQGGTRIIYFTRLLSGRIYL
LLIYPKNVKDDLNENEKAMLKVFTRQINL
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|