Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5210401..5210987 | Replicon | chromosome |
| Accession | NZ_CP102593 | ||
| Organism | Xanthomonas campestris pv. phormiicola strain CFBP 8444 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | NRY95_RS22125 | Protein ID | WP_228320811.1 |
| Coordinates | 5210706..5210987 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NRY95_RS22120 | Protein ID | WP_185814804.1 |
| Coordinates | 5210401..5210691 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NRY95_RS22090 (NRY95_22095) | 5205757..5205966 | - | 210 | WP_263393222.1 | DUF4424 domain-containing protein | - |
| NRY95_RS22095 (NRY95_22100) | 5206414..5206986 | + | 573 | WP_263393223.1 | lysozyme inhibitor LprI family protein | - |
| NRY95_RS22100 (NRY95_22105) | 5206937..5207623 | - | 687 | WP_263393224.1 | hypothetical protein | - |
| NRY95_RS22105 (NRY95_22110) | 5208516..5208899 | + | 384 | WP_228320813.1 | BA14K family protein | - |
| NRY95_RS22110 (NRY95_22115) | 5209018..5209461 | - | 444 | WP_228320819.1 | hypothetical protein | - |
| NRY95_RS22115 (NRY95_22120) | 5209590..5210252 | - | 663 | WP_228320812.1 | hemolysin III family protein | - |
| NRY95_RS22120 (NRY95_22125) | 5210401..5210691 | - | 291 | WP_185814804.1 | HigA family addiction module antitoxin | Antitoxin |
| NRY95_RS22125 (NRY95_22130) | 5210706..5210987 | - | 282 | WP_228320811.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NRY95_RS22130 (NRY95_22135) | 5211158..5213653 | + | 2496 | WP_228320810.1 | DEAD/DEAH box helicase | - |
| NRY95_RS22135 (NRY95_22140) | 5213882..5214997 | + | 1116 | WP_228320809.1 | ribonuclease H-like domain-containing protein | - |
| NRY95_RS22140 (NRY95_22145) | 5215186..5215547 | - | 362 | Protein_4362 | saccharopine dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10712.22 Da Isoelectric Point: 9.0320
>T253878 WP_228320811.1 NZ_CP102593:c5210987-5210706 [Xanthomonas campestris pv. phormiicola]
VIRNFVDKEAEKIWQGTPSRRLPADIQAVARRKLRMLNSAAILDDLRVPPADHLEALKGNRKGQYSIRINDQSRVCFQWK
DGDALDVEIVDYH
VIRNFVDKEAEKIWQGTPSRRLPADIQAVARRKLRMLNSAAILDDLRVPPADHLEALKGNRKGQYSIRINDQSRVCFQWK
DGDALDVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|