Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 3925365..3925969 | Replicon | chromosome |
Accession | NZ_CP102593 | ||
Organism | Xanthomonas campestris pv. phormiicola strain CFBP 8444 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NRY95_RS16305 | Protein ID | WP_228320555.1 |
Coordinates | 3925649..3925969 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NRY95_RS16300 | Protein ID | WP_228320554.1 |
Coordinates | 3925365..3925652 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NRY95_RS16290 (NRY95_16295) | 3920962..3924153 | + | 3192 | WP_228320552.1 | error-prone DNA polymerase | - |
NRY95_RS16295 (NRY95_16300) | 3924204..3924494 | - | 291 | WP_228320553.1 | hypothetical protein | - |
NRY95_RS16300 (NRY95_16305) | 3925365..3925652 | - | 288 | WP_228320554.1 | NadS family protein | Antitoxin |
NRY95_RS16305 (NRY95_16310) | 3925649..3925969 | - | 321 | WP_228320555.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NRY95_RS16310 (NRY95_16315) | 3926091..3926534 | - | 444 | WP_228320556.1 | nuclear transport factor 2 family protein | - |
NRY95_RS16315 (NRY95_16320) | 3926658..3927380 | + | 723 | WP_228320557.1 | helix-turn-helix transcriptional regulator | - |
NRY95_RS16320 (NRY95_16325) | 3927377..3928141 | - | 765 | WP_228320559.1 | endonuclease | - |
NRY95_RS16330 (NRY95_16335) | 3929197..3929550 | - | 354 | WP_228320561.1 | PilZ domain-containing protein | - |
NRY95_RS16335 (NRY95_16340) | 3929547..3930509 | - | 963 | WP_228320562.1 | DNA polymerase III subunit delta' | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12145.02 Da Isoelectric Point: 9.7151
>T253875 WP_228320555.1 NZ_CP102593:c3925969-3925649 [Xanthomonas campestris pv. phormiicola]
MILVETPLFTRRVKELLDDETYSTFQVVLRENPEAGDLIEGTGGLRKVRVAAKGHGKRGGARVIYYHFVSIDTIALLMIY
PKNEQRDLTNAERKALKGIIEHWRYS
MILVETPLFTRRVKELLDDETYSTFQVVLRENPEAGDLIEGTGGLRKVRVAAKGHGKRGGARVIYYHFVSIDTIALLMIY
PKNEQRDLTNAERKALKGIIEHWRYS
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|