Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5036339..5036925 | Replicon | chromosome |
| Accession | NZ_CP102592 | ||
| Organism | Xanthomonas sp. CFBP 8443 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | NUG20_RS21030 | Protein ID | WP_263396307.1 |
| Coordinates | 5036644..5036925 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NUG20_RS21025 | Protein ID | WP_263396306.1 |
| Coordinates | 5036339..5036629 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUG20_RS20995 (NUG20_21000) | 5032209..5032544 | - | 336 | WP_263396300.1 | thioredoxin family protein | - |
| NUG20_RS21000 (NUG20_21005) | 5032553..5032951 | - | 399 | WP_263396301.1 | host attachment family protein | - |
| NUG20_RS21005 (NUG20_21010) | 5033091..5033990 | - | 900 | WP_263396302.1 | DUF4424 domain-containing protein | - |
| NUG20_RS21010 (NUG20_21015) | 5034318..5034863 | + | 546 | WP_263396303.1 | lysozyme inhibitor LprI family protein | - |
| NUG20_RS21015 (NUG20_21020) | 5034975..5035427 | - | 453 | WP_263396304.1 | hypothetical protein | - |
| NUG20_RS21020 (NUG20_21025) | 5035529..5036185 | - | 657 | WP_263396305.1 | hemolysin III family protein | - |
| NUG20_RS21025 (NUG20_21030) | 5036339..5036629 | - | 291 | WP_263396306.1 | HigA family addiction module antitoxin | Antitoxin |
| NUG20_RS21030 (NUG20_21035) | 5036644..5036925 | - | 282 | WP_263396307.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NUG20_RS21035 (NUG20_21040) | 5037096..5039591 | + | 2496 | WP_263396308.1 | DEAD/DEAH box helicase | - |
| NUG20_RS21040 (NUG20_21045) | 5039811..5040926 | + | 1116 | WP_263396309.1 | ribonuclease H-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10777.30 Da Isoelectric Point: 9.8794
>T253873 WP_263396307.1 NZ_CP102592:c5036925-5036644 [Xanthomonas sp. CFBP 8443]
VIRNFVDKEAEKIWQGTPSRRLPADIQVVARRKLRMLNSAATLDDLRVPPANRLEALKGDRKGQHSTRINDPWRVCFQWK
DGDALDVEIVDYH
VIRNFVDKEAEKIWQGTPSRRLPADIQVVARRKLRMLNSAATLDDLRVPPANRLEALKGDRKGQHSTRINDPWRVCFQWK
DGDALDVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|