Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 813..1443 | Replicon | plasmid p2 |
| Accession | NZ_CP102554 | ||
| Organism | Klebsiella pneumoniae strain KPH3 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3V9PY09 |
| Locus tag | NUG48_RS26670 | Protein ID | WP_001708474.1 |
| Coordinates | 1108..1443 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A704FLZ1 |
| Locus tag | NUG48_RS26665 | Protein ID | WP_001708475.1 |
| Coordinates | 813..1103 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUG48_RS26660 (NUG48_26665) | 100..753 | - | 654 | WP_001708476.1 | hypothetical protein | - |
| NUG48_RS26665 (NUG48_26670) | 813..1103 | - | 291 | WP_001708475.1 | NadS family protein | Antitoxin |
| NUG48_RS26670 (NUG48_26675) | 1108..1443 | - | 336 | WP_001708474.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NUG48_RS26675 (NUG48_26680) | 1648..2316 | - | 669 | WP_257874035.1 | hypothetical protein | - |
| NUG48_RS26680 (NUG48_26685) | 2366..2692 | - | 327 | WP_044296048.1 | hypothetical protein | - |
| NUG48_RS26685 (NUG48_26690) | 3005..3565 | - | 561 | WP_044296046.1 | hypothetical protein | - |
| NUG48_RS26690 (NUG48_26695) | 3583..3933 | - | 351 | WP_001708471.1 | hypothetical protein | - |
| NUG48_RS26695 (NUG48_26700) | 3968..4303 | - | 336 | WP_044296044.1 | hypothetical protein | - |
| NUG48_RS26700 (NUG48_26705) | 4300..4569 | - | 270 | WP_024172976.1 | hypothetical protein | - |
| NUG48_RS26705 (NUG48_26710) | 4583..4960 | - | 378 | WP_024172975.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..43141 | 43141 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12615.30 Da Isoelectric Point: 5.2407
>T253865 WP_001708474.1 NZ_CP102554:c1443-1108 [Klebsiella pneumoniae]
MEYYEFVETSVFTREMKTLLSDDEYKEFQTFLIENPEAGDLIVGTGGCRKVRWSRQGTGKSSGVRAIYYFYNPAGRLYML
IIYPKSEKDSLTAAEKNQLKAVVAGFKGEEG
MEYYEFVETSVFTREMKTLLSDDEYKEFQTFLIENPEAGDLIVGTGGCRKVRWSRQGTGKSSGVRAIYYFYNPAGRLYML
IIYPKSEKDSLTAAEKNQLKAVVAGFKGEEG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V9PY09 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A704FLZ1 |