Detailed information of TA system TA253844

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 67457..67878
• Replicon: plasmid p2
• Accession: NZ_CP102548
• Organism: Klebsiella pneumoniae strain KPH1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NUG47_RS27330
• Protein ID: WP_096937776.1
• Coordinates: 67457..67582 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	67680..67878 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NUG47_RS27290 (62521)	62521..62736	-	216	WP_001352842.1	conjugal transfer relaxosome protein TraY	-
NUG47_RS27295 (62872)	62872..63519	-	648	WP_000332520.1	conjugal transfer transcriptional regulator TraJ	-
NUG47_RS27300 (63710)	63710..64093	-	384	WP_001063020.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NUG47_RS27305 (64463)	64463..65035	+	573	WP_000949660.1	transglycosylase SLT domain-containing protein	-
NUG47_RS27310 (65331)	65331..66152	-	822	WP_001234465.1	DUF932 domain-containing protein	-
NUG47_RS27315 (66271)	66271..66558	-	288	Protein_88	hypothetical protein	-
NUG47_RS27320 (66583)	66583..66789	-	207	WP_000275854.1	hypothetical protein	-
NUG47_RS27325 (66859)	66859..67156	+	298	Protein_90	hypothetical protein	-
NUG47_RS27330 (67457)	67457..67582	-	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
NUG47_RS27335 (67524)	67524..67673	-	150	Protein_92	DUF5431 family protein	-
- (67680)	67680..67878	-	199	NuclAT_0	-	Antitoxin
- (67680)	67680..67878	-	199	NuclAT_0	-	Antitoxin
- (67680)	67680..67878	-	199	NuclAT_0	-	Antitoxin
- (67680)	67680..67878	-	199	NuclAT_0	-	Antitoxin
NUG47_RS27340 (68107)	68107..68424	+	318	Protein_93	IS110 family transposase	-
NUG47_RS27345 (68713)	68713..68964	-	252	Protein_94	iron-containing alcohol dehydrogenase	-
NUG47_RS27350 (69049)	69049..69672	-	624	WP_000912556.1	ion channel	-
NUG47_RS27360 (70442)	70442..70546	+	105	Protein_97	thiosulfate reductase cytochrome B subunit	-
NUG47_RS27365 (70792)	70792..72186	-	1395	WP_001037799.1	carbohydrate porin	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(B) / dfrA12 / aadA2 / qacE / sul1 / blaNDM-1	-	1..125297	125297
	-	flank	IS/Tn	-	-	68056..68424	368

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T253844 WP_096937776.1 NZ_CP102548:c67582-67457 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 199 bp

>AT253844 NZ_CP102548:c67878-67680 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGTCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC

Structures

Antitoxin