Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 50706..50960 | Replicon | plasmid p2 |
| Accession | NZ_CP102548 | ||
| Organism | Klebsiella pneumoniae strain KPH1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NUG47_RS27200 | Protein ID | WP_001312851.1 |
| Coordinates | 50706..50855 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 50899..50960 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUG47_RS27170 (45953) | 45953..46864 | - | 912 | WP_000440183.1 | carbamate kinase | - |
| NUG47_RS27175 (46875) | 46875..48095 | - | 1221 | WP_000410951.1 | arginine deiminase | - |
| NUG47_RS27180 (48829) | 48829..49416 | + | 588 | Protein_61 | VENN motif pre-toxin domain-containing protein | - |
| NUG47_RS27185 (49416) | 49416..49862 | - | 447 | Protein_62 | plasmid replication initiator RepA | - |
| NUG47_RS27190 (49855) | 49855..49929 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| NUG47_RS27195 (50165) | 50165..50422 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| NUG47_RS27200 (50706) | 50706..50855 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (50899) | 50899..50960 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (50899) | 50899..50960 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (50899) | 50899..50960 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (50899) | 50899..50960 | + | 62 | NuclAT_1 | - | Antitoxin |
| NUG47_RS27205 (51099) | 51099..51281 | - | 183 | WP_000968309.1 | hypothetical protein | - |
| NUG47_RS27210 (51382) | 51382..52088 | + | 707 | WP_228719446.1 | IS1 family transposase | - |
| NUG47_RS27215 (52389) | 52389..52601 | - | 213 | WP_005012601.1 | hypothetical protein | - |
| NUG47_RS27220 (52734) | 52734..53294 | - | 561 | WP_000139363.1 | fertility inhibition protein FinO | - |
| NUG47_RS27225 (53349) | 53349..54095 | - | 747 | WP_094083868.1 | conjugal transfer pilus acetylase TraX | - |
| NUG47_RS27230 (54115) | 54115..55305 | - | 1191 | Protein_71 | conjugative transfer relaxase/helicase TraI | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / dfrA12 / aadA2 / qacE / sul1 / blaNDM-1 | - | 1..125297 | 125297 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T253843 WP_001312851.1 NZ_CP102548:c50855-50706 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT253843 NZ_CP102548:50899-50960 [Klebsiella pneumoniae]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
