Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3990144..3990784 | Replicon | chromosome |
Accession | NZ_CP102546 | ||
Organism | Klebsiella pneumoniae strain KPH1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | W9BBY1 |
Locus tag | NUG47_RS19550 | Protein ID | WP_016529833.1 |
Coordinates | 3990144..3990491 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NUG47_RS19555 | Protein ID | WP_040181955.1 |
Coordinates | 3990491..3990784 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUG47_RS19540 (3986070) | 3986070..3987503 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
NUG47_RS19545 (3987521) | 3987521..3989968 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
NUG47_RS19550 (3990144) | 3990144..3990491 | + | 348 | WP_016529833.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NUG47_RS19555 (3990491) | 3990491..3990784 | + | 294 | WP_040181955.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NUG47_RS19560 (3990854) | 3990854..3992362 | - | 1509 | WP_023301456.1 | glycerol-3-phosphate dehydrogenase | - |
NUG47_RS19565 (3992567) | 3992567..3992896 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
NUG47_RS19570 (3992947) | 3992947..3993777 | + | 831 | WP_024622927.1 | rhomboid family intramembrane serine protease GlpG | - |
NUG47_RS19575 (3993827) | 3993827..3994585 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13549.56 Da Isoelectric Point: 5.6749
>T253840 WP_016529833.1 NZ_CP102546:3990144-3990491 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|