Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3963955..3964541 Replicon chromosome
Accession NZ_CP102546
Organism Klebsiella pneumoniae strain KPH1

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag NUG47_RS19440 Protein ID WP_023285605.1
Coordinates 3964173..3964541 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NUG47_RS19435 Protein ID WP_004174006.1
Coordinates 3963955..3964176 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUG47_RS19415 (3960112) 3960112..3961038 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NUG47_RS19420 (3961035) 3961035..3962312 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NUG47_RS19425 (3962309) 3962309..3963076 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NUG47_RS19430 (3963078) 3963078..3963791 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NUG47_RS19435 (3963955) 3963955..3964176 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NUG47_RS19440 (3964173) 3964173..3964541 + 369 WP_023285605.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NUG47_RS19445 (3964814) 3964814..3966130 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NUG47_RS19450 (3966237) 3966237..3967124 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NUG47_RS19455 (3967121) 3967121..3967966 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NUG47_RS19460 (3967968) 3967968..3969038 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 3961035..3969775 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13534.89 Da        Isoelectric Point: 8.6410

>T253839 WP_023285605.1 NZ_CP102546:3964173-3964541 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGITVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT253839 WP_004174006.1 NZ_CP102546:3963955-3964176 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References