Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-RelB |
Location | 2718482..2719004 | Replicon | chromosome |
Accession | NZ_CP102542 | ||
Organism | Lacticaseibacillus rhamnosus strain GR-1 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | C2JUK2 |
Locus tag | NUU07_RS12555 | Protein ID | WP_005687756.1 |
Coordinates | 2718744..2719004 (+) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | C2JUK3 |
Locus tag | NUU07_RS12550 | Protein ID | WP_005687754.1 |
Coordinates | 2718482..2718751 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUU07_RS12530 (NUU07_12530) | 2714068..2714637 | - | 570 | WP_005687747.1 | PTS glucitol/sorbitol transporter subunit IIC | - |
NUU07_RS12535 (NUU07_12535) | 2714650..2715160 | - | 511 | Protein_2429 | transcriptional regulator GutM | - |
NUU07_RS12540 (NUU07_12540) | 2715161..2717029 | - | 1869 | WP_014571687.1 | HTH domain-containing protein | - |
NUU07_RS12545 (NUU07_12545) | 2717056..2717856 | - | 801 | WP_005690776.1 | SDR family oxidoreductase | - |
NUU07_RS12550 (NUU07_12550) | 2718482..2718751 | + | 270 | WP_005687754.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
NUU07_RS12555 (NUU07_12555) | 2718744..2719004 | + | 261 | WP_005687756.1 | Txe/YoeB family addiction module toxin | Toxin |
NUU07_RS12560 (NUU07_12560) | 2719215..2719943 | - | 729 | WP_014571689.1 | L-ribulose-5-phosphate 4-epimerase | - |
NUU07_RS12565 (NUU07_12565) | 2720140..2720961 | + | 822 | WP_005690770.1 | Cof-type HAD-IIB family hydrolase | - |
NUU07_RS12570 (NUU07_12570) | 2721028..2721915 | - | 888 | WP_014571690.1 | L-ribulose-5-phosphate 3-epimerase | - |
NUU07_RS12575 (NUU07_12575) | 2722100..2722879 | - | 780 | WP_005690765.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
NUU07_RS12580 (NUU07_12580) | 2722947..2723588 | - | 642 | WP_005690763.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10485.91 Da Isoelectric Point: 9.6577
>T253828 WP_005687756.1 NZ_CP102542:2718744-2719004 [Lacticaseibacillus rhamnosus]
MIKTWTDDAWADYMYWHDQNDKRTIKRINQLIQAIDRDPYKGIGKPEPLRYALTGKWSRRIDQENRIIYSIEKNHINIFA
CRTHYS
MIKTWTDDAWADYMYWHDQNDKRTIKRINQLIQAIDRDPYKGIGKPEPLRYALTGKWSRRIDQENRIIYSIEKNHINIFA
CRTHYS
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A249N526 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A249N594 |