Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
Location | 1731133..1731647 | Replicon | chromosome |
Accession | NZ_CP102532 | ||
Organism | Limosilactobacillus fermentum strain PCC |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | A0A6C1EMT8 |
Locus tag | NUU04_RS08945 | Protein ID | WP_035437199.1 |
Coordinates | 1731133..1731396 (-) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | NUU04_RS08950 | Protein ID | WP_035437201.1 |
Coordinates | 1731393..1731647 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUU04_RS08930 (NUU04_08930) | 1726609..1727391 | + | 783 | WP_035437193.1 | arginine deiminase-related protein | - |
NUU04_RS08935 (NUU04_08935) | 1727779..1729176 | + | 1398 | WP_035437196.1 | Na+/H+ antiporter NhaC family protein | - |
NUU04_RS08940 (NUU04_08940) | 1729602..1730723 | + | 1122 | WP_080650628.1 | PTS sugar transporter subunit IIC | - |
NUU04_RS08945 (NUU04_08945) | 1731133..1731396 | - | 264 | WP_035437199.1 | Txe/YoeB family addiction module toxin | Toxin |
NUU04_RS08950 (NUU04_08950) | 1731393..1731647 | - | 255 | WP_035437201.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NUU04_RS08955 (NUU04_08955) | 1731896..1732183 | + | 288 | WP_041807836.1 | transposase | - |
NUU04_RS08960 (NUU04_08960) | 1732207..1733085 | + | 879 | WP_086031809.1 | IS3 family transposase | - |
NUU04_RS08965 (NUU04_08965) | 1733401..1733862 | + | 462 | WP_204022139.1 | hypothetical protein | - |
NUU04_RS08970 (NUU04_08970) | 1733883..1734647 | + | 765 | WP_080650602.1 | zinc ribbon domain-containing protein | - |
NUU04_RS08975 (NUU04_08975) | 1734854..1735699 | - | 846 | WP_086031810.1 | IS3 family transposase | - |
NUU04_RS08980 (NUU04_08980) | 1735696..1736310 | - | 615 | WP_035431426.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10252.94 Da Isoelectric Point: 10.3349
>T253813 WP_035437199.1 NZ_CP102532:c1731396-1731133 [Limosilactobacillus fermentum]
MSYAIKLKRSANKDLKKIKGSYLEKSFLQIIEQLRKDPLAPNQGFEKLVLPIKGFYSRRINIQHRLVYKVDQDTQTVIIY
SAWSHDE
MSYAIKLKRSANKDLKKIKGSYLEKSFLQIIEQLRKDPLAPNQGFEKLVLPIKGFYSRRINIQHRLVYKVDQDTQTVIIY
SAWSHDE
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|