Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-DinJ |
| Location | 1379513..1380077 | Replicon | chromosome |
| Accession | NZ_CP102530 | ||
| Organism | Lacticaseibacillus paracasei subsp. paracasei strain 01 | ||
Toxin (Protein)
| Gene name | yafQ | Uniprot ID | A0A6G9EML4 |
| Locus tag | NUU02_RS07050 | Protein ID | WP_014951859.1 |
| Coordinates | 1379775..1380077 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | K6SLT0 |
| Locus tag | NUU02_RS07045 | Protein ID | WP_003570051.1 |
| Coordinates | 1379513..1379782 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUU02_RS07015 (NUU02_07015) | 1374517..1375404 | - | 888 | WP_012491506.1 | ABC transporter ATP-binding protein | - |
| NUU02_RS07020 (NUU02_07020) | 1375602..1376828 | - | 1227 | WP_012491507.1 | hypothetical protein | - |
| NUU02_RS07025 (NUU02_07025) | 1377026..1377430 | + | 405 | WP_012491508.1 | MerR family transcriptional regulator | - |
| NUU02_RS07030 (NUU02_07030) | 1377423..1377749 | + | 327 | WP_012491509.1 | YrdB family protein | - |
| NUU02_RS07035 (NUU02_07035) | 1377812..1378441 | + | 630 | WP_012491510.1 | DUF2399 domain-containing protein | - |
| NUU02_RS07040 (NUU02_07040) | 1378486..1379139 | + | 654 | WP_012491511.1 | N-acetyltransferase | - |
| NUU02_RS07045 (NUU02_07045) | 1379513..1379782 | + | 270 | WP_003570051.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NUU02_RS07050 (NUU02_07050) | 1379775..1380077 | + | 303 | WP_014951859.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| NUU02_RS07055 (NUU02_07055) | 1380416..1380559 | + | 144 | WP_003574774.1 | hypothetical protein | - |
| NUU02_RS07060 (NUU02_07060) | 1380677..1381369 | + | 693 | WP_012491513.1 | hypothetical protein | - |
| NUU02_RS07065 (NUU02_07065) | 1381605..1383782 | + | 2178 | WP_012491514.1 | Tex family protein | - |
| NUU02_RS07070 (NUU02_07070) | 1383847..1384776 | - | 930 | WP_003599410.1 | IS30-like element ISLpl1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1383847..1384776 | 929 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11441.27 Da Isoelectric Point: 10.2818
>T253811 WP_014951859.1 NZ_CP102530:1379775-1380077 [Lacticaseibacillus paracasei subsp. paracasei]
MYSLVPTPTFKRDLKRLSKKHWPMDELKTAVNLLAAGTNAELLSKKYADHALSSSSEWKGYRELHVDGPRGDWLLIYKIK
QQDLILTLVRTGSHHNLLGK
MYSLVPTPTFKRDLKRLSKKHWPMDELKTAVNLLAAGTNAELLSKKYADHALSSSSEWKGYRELHVDGPRGDWLLIYKIK
QQDLILTLVRTGSHHNLLGK
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6G9EML4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E2BRK6 |