Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/YoeB-YefM
Location 4753872..4754404 Replicon chromosome
Accession NZ_CP102514
Organism Streptomyces yangpuensis strain CM253

Toxin (Protein)


Gene name yoeB Uniprot ID -
Locus tag NRK68_RS21940 Protein ID WP_183069749.1
Coordinates 4754150..4754404 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID -
Locus tag NRK68_RS21935 Protein ID WP_183069750.1
Coordinates 4753872..4754153 (+) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NRK68_RS21895 (NRK68_21895) 4748997..4750151 - 1155 WP_257856498.1 caspase family protein -
NRK68_RS21900 (NRK68_21900) 4750148..4750507 - 360 WP_257856499.1 hypothetical protein -
NRK68_RS21905 (NRK68_21905) 4750663..4751292 - 630 WP_257857902.1 DUF6000 family protein -
NRK68_RS21910 (NRK68_21910) 4751295..4752026 - 732 WP_257856500.1 HEAT repeat domain-containing protein -
NRK68_RS21915 (NRK68_21915) 4752023..4752409 - 387 WP_257856501.1 CPCC family cysteine-rich protein -
NRK68_RS21920 (NRK68_21920) 4752750..4753013 - 264 WP_144381307.1 type II toxin-antitoxin system RelE/ParE family toxin -
NRK68_RS21925 (NRK68_21925) 4753006..4753275 - 270 WP_007266282.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
NRK68_RS21930 (NRK68_21930) 4753596..4753793 - 198 Protein_4310 type II toxin-antitoxin system RelE/ParE family toxin -
NRK68_RS21935 (NRK68_21935) 4753872..4754153 + 282 WP_183069750.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
NRK68_RS21940 (NRK68_21940) 4754150..4754404 + 255 WP_183069749.1 Txe/YoeB family addiction module toxin Toxin
NRK68_RS21945 (NRK68_21945) 4754529..4755110 - 582 WP_183069748.1 Uma2 family endonuclease -
NRK68_RS21950 (NRK68_21950) 4755417..4756484 - 1068 WP_257856503.1 phosphoribosylformylglycinamidine cyclo-ligase -
NRK68_RS21955 (NRK68_21955) 4756519..4757406 - 888 WP_183069789.1 NAD(P)-dependent oxidoreductase -
NRK68_RS21960 (NRK68_21960) 4757403..4758983 - 1581 WP_257856504.1 class I adenylate-forming enzyme family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(2-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(2-65)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9984.46 Da        Isoelectric Point: 8.4461

>T253809 WP_183069749.1 NZ_CP102514:4754150-4754404 [Streptomyces yangpuensis]
VRLVFEDQGWEDYTSGLKSDRKMLARINKLIEDVRRDPFSGIGKPEPLKYHLPGAWSRRIDDEHRLVYLVTEKEIIILAA
RYHY

Download         Length: 255 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10076.33 Da        Isoelectric Point: 5.1373

>AT253809 WP_183069750.1 NZ_CP102514:4753872-4754153 [Streptomyces yangpuensis]
MSITASEARRELFPLIKKVNENHEAIEIVSKHGNAVLVSAEDYAALREGSYLLRSPVNARRLLKAYENALANINVSEREL
IDPDSADAGAGAA

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References