Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4584905..4585575 | Replicon | chromosome |
Accession | NZ_CP102500 | ||
Organism | Citrobacter youngae strain CF10 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A6N6JXY6 |
Locus tag | NUG39_RS22090 | Protein ID | WP_046671374.1 |
Coordinates | 4585273..4585575 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NUG39_RS22085 | Protein ID | WP_048213890.1 |
Coordinates | 4584905..4585246 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUG39_RS22055 (4580526) | 4580526..4581284 | + | 759 | WP_048213884.1 | phosphonate C-P lyase system protein PhnK | - |
NUG39_RS22060 (4581294) | 4581294..4581974 | + | 681 | WP_115644030.1 | phosphonate C-P lyase system protein PhnL | - |
NUG39_RS22065 (4581971) | 4581971..4583107 | + | 1137 | WP_257748446.1 | alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase | - |
NUG39_RS22070 (4583110) | 4583110..4583664 | + | 555 | WP_101742857.1 | ribose 1,5-bisphosphokinase | - |
NUG39_RS22075 (4583651) | 4583651..4584085 | + | 435 | WP_116360963.1 | aminoalkylphosphonate N-acetyltransferase | - |
NUG39_RS22080 (4584094) | 4584094..4584852 | + | 759 | WP_257748447.1 | phosphonate metabolism protein PhnP | - |
NUG39_RS22085 (4584905) | 4584905..4585246 | - | 342 | WP_048213890.1 | HigA family addiction module antitoxin | Antitoxin |
NUG39_RS22090 (4585273) | 4585273..4585575 | - | 303 | WP_046671374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NUG39_RS22095 (4585731) | 4585731..4586060 | - | 330 | WP_172743423.1 | DDRRRQL repeat protein YjdP | - |
NUG39_RS22100 (4586130) | 4586130..4588394 | - | 2265 | WP_257748448.1 | hybrid sensor histidine kinase/response regulator | - |
NUG39_RS22105 (4588509) | 4588509..4590032 | + | 1524 | WP_257748449.1 | sugar ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11819.43 Da Isoelectric Point: 9.9581
>T253790 WP_046671374.1 NZ_CP102500:c4585575-4585273 [Citrobacter youngae]
MSKSLNIRSFRDTWLEDFFERATSHRKIPADIHTALARKLDIINAAVSHRDLRSPPGNRYEELTGKLQEYSSIRVNKQYR
LIFKWVNGKAEDVYLDPHIY
MSKSLNIRSFRDTWLEDFFERATSHRKIPADIHTALARKLDIINAAVSHRDLRSPPGNRYEELTGKLQEYSSIRVNKQYR
LIFKWVNGKAEDVYLDPHIY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|