Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3015730..3016390 | Replicon | chromosome |
| Accession | NZ_CP102500 | ||
| Organism | Citrobacter youngae strain CF10 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NUG39_RS14795 | Protein ID | WP_257748004.1 |
| Coordinates | 3016037..3016390 (-) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NUG39_RS14790 | Protein ID | WP_257748003.1 |
| Coordinates | 3015730..3016032 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUG39_RS14780 (3012491) | 3012491..3013753 | + | 1263 | WP_257748001.1 | integrase arm-type DNA-binding domain-containing protein | - |
| NUG39_RS14785 (3014334) | 3014334..3015221 | - | 888 | WP_257748002.1 | integrase domain-containing protein | - |
| NUG39_RS14790 (3015730) | 3015730..3016032 | - | 303 | WP_257748003.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NUG39_RS14795 (3016037) | 3016037..3016390 | - | 354 | WP_257748004.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NUG39_RS14800 (3016887) | 3016887..3017093 | - | 207 | WP_257748005.1 | helix-turn-helix transcriptional regulator | - |
| NUG39_RS14805 (3017090) | 3017090..3017557 | - | 468 | WP_257748006.1 | hypothetical protein | - |
| NUG39_RS14810 (3017862) | 3017862..3018863 | - | 1002 | WP_257748007.1 | DUF4917 family protein | - |
| NUG39_RS14815 (3019141) | 3019141..3020376 | + | 1236 | WP_257748008.1 | DNA cytosine methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13425.38 Da Isoelectric Point: 7.5863
>T253785 WP_257748004.1 NZ_CP102500:c3016390-3016037 [Citrobacter youngae]
MWTIKTTDRFDDWFSALCATDRACVLASLLVLREKGPGLPRPYADTIKGSCYNNMKELRVQSRGDPIRIFFAFDPYRTGI
LLCAGNKVGNEKRFYNQMVAVADREFAEYLNTLDDKE
MWTIKTTDRFDDWFSALCATDRACVLASLLVLREKGPGLPRPYADTIKGSCYNNMKELRVQSRGDPIRIFFAFDPYRTGI
LLCAGNKVGNEKRFYNQMVAVADREFAEYLNTLDDKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|