Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 336264..336850 Replicon chromosome
Accession NZ_CP102490
Organism Klebsiella pneumoniae strain BA13643

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag LCN95_RS01575 Protein ID WP_002920800.1
Coordinates 336482..336850 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag LCN95_RS01570 Protein ID WP_004174006.1
Coordinates 336264..336485 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LCN95_RS01550 (LCN95_01550) 332421..333347 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
LCN95_RS01555 (LCN95_01555) 333344..334621 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
LCN95_RS01560 (LCN95_01560) 334618..335385 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
LCN95_RS01565 (LCN95_01565) 335387..336100 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
LCN95_RS01570 (LCN95_01570) 336264..336485 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
LCN95_RS01575 (LCN95_01575) 336482..336850 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
LCN95_RS01580 (LCN95_01580) 337123..338439 + 1317 WP_019704662.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
LCN95_RS01585 (LCN95_01585) 338546..339433 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
LCN95_RS01590 (LCN95_01590) 339430..340275 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
LCN95_RS01595 (LCN95_01595) 340277..341347 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 333344..342084 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T253761 WP_002920800.1 NZ_CP102490:336482-336850 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT253761 WP_004174006.1 NZ_CP102490:336264-336485 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References