Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 4529060..4529753 | Replicon | chromosome |
Accession | NZ_CP102488 | ||
Organism | Escherichia coli O15:H18 strain ST69 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | NUI00_RS22055 | Protein ID | WP_000415584.1 |
Coordinates | 4529060..4529356 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | NUI00_RS22060 | Protein ID | WP_000650107.1 |
Coordinates | 4529358..4529753 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUI00_RS22020 (4524139) | 4524139..4524453 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
NUI00_RS22025 (4524484) | 4524484..4525065 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
NUI00_RS22030 (4525393) | 4525393..4525725 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
NUI00_RS22035 (4525771) | 4525771..4527120 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
NUI00_RS22040 (4527117) | 4527117..4527776 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
NUI00_RS22045 (4527928) | 4527928..4528320 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
NUI00_RS22050 (4528373) | 4528373..4528855 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
NUI00_RS22055 (4529060) | 4529060..4529356 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
NUI00_RS22060 (4529358) | 4529358..4529753 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
NUI00_RS22065 (4529886) | 4529886..4531493 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
NUI00_RS22070 (4531631) | 4531631..4533889 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T253756 WP_000415584.1 NZ_CP102488:4529060-4529356 [Escherichia coli O15:H18]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT253756 WP_000650107.1 NZ_CP102488:4529358-4529753 [Escherichia coli O15:H18]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|