Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4423307..4424106 | Replicon | chromosome |
Accession | NZ_CP102488 | ||
Organism | Escherichia coli O15:H18 strain ST69 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | B7NDB6 |
Locus tag | NUI00_RS21530 | Protein ID | WP_000347269.1 |
Coordinates | 4423307..4423771 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | V0YUB5 |
Locus tag | NUI00_RS21535 | Protein ID | WP_001309780.1 |
Coordinates | 4423771..4424106 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUI00_RS21500 (4418308) | 4418308..4418742 | - | 435 | WP_000948818.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
NUI00_RS21505 (4418760) | 4418760..4419638 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NUI00_RS21510 (4419628) | 4419628..4420407 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NUI00_RS21515 (4420418) | 4420418..4420891 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NUI00_RS21520 (4420914) | 4420914..4422194 | - | 1281 | WP_000681943.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NUI00_RS21525 (4422443) | 4422443..4423252 | + | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
NUI00_RS21530 (4423307) | 4423307..4423771 | - | 465 | WP_000347269.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NUI00_RS21535 (4423771) | 4423771..4424106 | - | 336 | WP_001309780.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NUI00_RS21540 (4424255) | 4424255..4425826 | - | 1572 | WP_001273738.1 | galactarate dehydratase | - |
NUI00_RS21545 (4426201) | 4426201..4427535 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
NUI00_RS21550 (4427551) | 4427551..4428321 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17806.22 Da Isoelectric Point: 9.6924
>T253754 WP_000347269.1 NZ_CP102488:c4423771-4423307 [Escherichia coli O15:H18]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTREAEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTREAEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829IY86 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0YUB5 |