Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1120574..1121136 | Replicon | chromosome |
Accession | NZ_CP102488 | ||
Organism | Escherichia coli O15:H18 strain ST69 |
Toxin (Protein)
Gene name | higB | Uniprot ID | L4J948 |
Locus tag | NUI00_RS05335 | Protein ID | WP_000605676.1 |
Coordinates | 1120574..1120852 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1PAQ1 |
Locus tag | NUI00_RS05340 | Protein ID | WP_000781370.1 |
Coordinates | 1120852..1121136 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUI00_RS05310 (1116160) | 1116160..1116591 | - | 432 | WP_000152305.1 | peroxiredoxin OsmC | - |
NUI00_RS05315 (1116936) | 1116936..1117151 | + | 216 | WP_000495766.1 | biofilm-dependent modulation protein | - |
NUI00_RS05320 (1117253) | 1117253..1117390 | + | 138 | WP_000841554.1 | stationary-phase-induced ribosome-associated protein | - |
NUI00_RS05325 (1117547) | 1117547..1119244 | + | 1698 | WP_000433464.1 | malate dehydrogenase | - |
NUI00_RS05330 (1119378) | 1119378..1120388 | + | 1011 | WP_000642407.1 | alcohol dehydrogenase AdhP | - |
NUI00_RS05335 (1120574) | 1120574..1120852 | + | 279 | WP_000605676.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NUI00_RS05340 (1120852) | 1120852..1121136 | + | 285 | WP_000781370.1 | HigA family addiction module antitoxin | Antitoxin |
NUI00_RS05345 (1121364) | 1121364..1122017 | - | 654 | WP_000045646.1 | formate dehydrogenase-N subunit gamma | - |
NUI00_RS05350 (1122010) | 1122010..1122894 | - | 885 | WP_001240565.1 | formate dehydrogenase N subunit beta | - |
NUI00_RS05355 (1122907) | 1122907..1125954 | - | 3048 | WP_012602782.1 | formate dehydrogenase-N subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10521.10 Da Isoelectric Point: 7.3562
>T253742 WP_000605676.1 NZ_CP102488:1120574-1120852 [Escherichia coli O15:H18]
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAASCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAASCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829G6T1 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2ICT | |
PDB | 2ICP | |
AlphaFold DB | A0A829CUG6 |