Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2432417..2433078 | Replicon | chromosome |
| Accession | NZ_CP102487 | ||
| Organism | Glutamicibacter halophytocola strain S2 | ||
Toxin (Protein)
| Gene name | HigB2 | Uniprot ID | - |
| Locus tag | NUH22_RS11300 | Protein ID | WP_236995176.1 |
| Coordinates | 2432728..2433078 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | HigA2 | Uniprot ID | - |
| Locus tag | NUH22_RS11295 | Protein ID | WP_236995175.1 |
| Coordinates | 2432417..2432731 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUH22_RS11275 (NUH22_11275) | 2427834..2429261 | + | 1428 | WP_194943653.1 | MFS transporter | - |
| NUH22_RS11280 (NUH22_11280) | 2429278..2430450 | + | 1173 | WP_257745334.1 | amidohydrolase | - |
| NUH22_RS11285 (NUH22_11285) | 2431358..2431894 | - | 537 | WP_146275611.1 | isochorismatase family protein | - |
| NUH22_RS11290 (NUH22_11290) | 2431894..2432196 | - | 303 | WP_060702101.1 | HigA family addiction module antitoxin | - |
| NUH22_RS11295 (NUH22_11295) | 2432417..2432731 | - | 315 | WP_236995175.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NUH22_RS11300 (NUH22_11300) | 2432728..2433078 | - | 351 | WP_236995176.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NUH22_RS11305 (NUH22_11305) | 2433231..2434316 | - | 1086 | WP_146275617.1 | redox-regulated ATPase YchF | - |
| NUH22_RS11310 (NUH22_11310) | 2434378..2435475 | - | 1098 | WP_060702139.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
| NUH22_RS11315 (NUH22_11315) | 2435576..2436769 | - | 1194 | WP_257745335.1 | SH3 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13113.89 Da Isoelectric Point: 4.4991
>T253735 WP_236995176.1 NZ_CP102487:c2433078-2432728 [Glutamicibacter halophytocola]
VDIELIELIEVWLAELDVDSREQVVAAIELLEDSGPQLGRPIVDTVKASRHKNIKELRPGSSGKSELRILFAFDPERAAI
MLIAGDKAGDWQGWYEKNLPHADRLFDEHLDKIRGE
VDIELIELIEVWLAELDVDSREQVVAAIELLEDSGPQLGRPIVDTVKASRHKNIKELRPGSSGKSELRILFAFDPERAAI
MLIAGDKAGDWQGWYEKNLPHADRLFDEHLDKIRGE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|