Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 333563..334149 Replicon chromosome
Accession NZ_CP102438
Organism Klebsiella pneumoniae strain hvKP248

Toxin (Protein)


Gene name doc Uniprot ID A0A7Z9B6M3
Locus tag NUJ53_RS01545 Protein ID WP_029884514.1
Coordinates 333781..334149 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NUJ53_RS01540 Protein ID WP_004174006.1
Coordinates 333563..333784 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUJ53_RS01520 (329720) 329720..330646 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NUJ53_RS01525 (330643) 330643..331920 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NUJ53_RS01530 (331917) 331917..332684 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NUJ53_RS01535 (332686) 332686..333399 + 714 WP_029884513.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NUJ53_RS01540 (333563) 333563..333784 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NUJ53_RS01545 (333781) 333781..334149 + 369 WP_029884514.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NUJ53_RS01550 (334422) 334422..335738 + 1317 WP_029884515.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NUJ53_RS01555 (335845) 335845..336732 + 888 WP_004901104.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NUJ53_RS01560 (336729) 336729..337574 + 846 WP_004901101.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NUJ53_RS01565 (337576) 337576..338646 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 330643..339383 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-116)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13583.01 Da        Isoelectric Point: 8.6410

>T253655 WP_029884514.1 NZ_CP102438:333781-334149 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRMALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT253655 WP_004174006.1 NZ_CP102438:333563-333784 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7Z9B6M3

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References