Detailed information of TA system TA253652

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 97968..98237
• Replicon: plasmid pK194-P2
• Accession: NZ_CP102437
• Organism: Klebsiella pneumoniae strain K194

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NR799_RS27350
• Protein ID: WP_001372321.1
• Coordinates: 98112..98237 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	97968..98033 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NR799_RS27320	93678..94205	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
NR799_RS27325	94263..94496	+	234	WP_000006003.1	DUF905 family protein	-
NR799_RS27330	94557..96580	+	2024	Protein_133	ParB/RepB/Spo0J family partition protein	-
NR799_RS27335	96649..97083	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
NR799_RS27340	97080..97799	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	97811..98035	+	225	NuclAT_0	-	-
-	97811..98035	+	225	NuclAT_0	-	-
-	97811..98035	+	225	NuclAT_0	-	-
-	97811..98035	+	225	NuclAT_0	-	-
-	97968..98033	-	66	-	-	Antitoxin
NR799_RS27345	98021..98170	+	150	Protein_136	plasmid maintenance protein Mok	-
NR799_RS27350	98112..98237	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NR799_RS27355	98556..98852	-	297	Protein_138	hypothetical protein	-
NR799_RS27360	99152..99448	+	297	WP_001272251.1	hypothetical protein	-
NR799_RS27365	99579..100559	+	981	WP_000019445.1	IS5-like element ISKpn26 family transposase	-
NR799_RS27370	100759..101580	+	822	WP_001234445.1	DUF932 domain-containing protein	-
NR799_RS27375	101877..102524	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
NR799_RS27380	102801..103184	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB / blaIMP-4 / qnrS1	-	1..163393	163393
	-	flank	IS/Tn	-	-	99579..100559	980

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T253652 WP_001372321.1 NZ_CP102437:98112-98237 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT253652 NZ_CP102437:c98033-97968 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin