Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 60904..61157 | Replicon | plasmid pK194-P2 |
| Accession | NZ_CP102437 | ||
| Organism | Klebsiella pneumoniae strain K194 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NR799_RS27100 | Protein ID | WP_001312851.1 |
| Coordinates | 61008..61157 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 60904..60963 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NR799_RS27065 (56345) | 56345..56545 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| NR799_RS27070 (56565) | 56565..57311 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| NR799_RS27075 (57366) | 57366..57926 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| NR799_RS27080 (58058) | 58058..58258 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| NR799_RS27085 (58290) | 58290..59258 | + | 969 | WP_013362812.1 | IS5-like element IS903B family transposase | - |
| NR799_RS27090 (59710) | 59710..60309 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| NR799_RS27095 (60371) | 60371..60703 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (60904) | 60904..60963 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (60904) | 60904..60963 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (60904) | 60904..60963 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (60904) | 60904..60963 | - | 60 | NuclAT_1 | - | Antitoxin |
| NR799_RS27100 (61008) | 61008..61157 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NR799_RS27105 (61441) | 61441..61689 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| NR799_RS27110 (61804) | 61804..61982 | + | 179 | Protein_89 | protein CopA/IncA | - |
| NR799_RS27115 (62001) | 62001..62858 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| NR799_RS27120 (63797) | 63797..64450 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| NR799_RS27125 (64543) | 64543..64800 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| NR799_RS27130 (64733) | 64733..65134 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| NR799_RS27135 (65383) | 65383..65798 | + | 416 | Protein_94 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB / blaIMP-4 / qnrS1 | - | 1..163393 | 163393 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T253648 WP_001312851.1 NZ_CP102437:61008-61157 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT253648 NZ_CP102437:c60963-60904 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
