Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 62199..62926 Replicon plasmid pK194-P1
Accession NZ_CP102436
Organism Klebsiella pneumoniae strain K194

Toxin (Protein)


Gene name higB Uniprot ID A0A7W3D9W1
Locus tag NR799_RS25665 Protein ID WP_011251285.1
Coordinates 62615..62926 (-) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NR799_RS25660 Protein ID WP_011251286.1
Coordinates 62199..62618 (-) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NR799_RS25635 (NR799_25635) 58031..58999 - 969 WP_013362812.1 IS5-like element IS903B family transposase -
NR799_RS25640 (NR799_25640) 59204..59824 + 621 WP_223175004.1 conjugative transfer protein MobI(A/C) -
NR799_RS25645 (NR799_25645) 59845..60633 + 789 WP_040217257.1 hypothetical protein -
NR799_RS25650 (NR799_25650) 60647..61012 + 366 WP_048333448.1 hypothetical protein -
NR799_RS25655 (NR799_25655) 61084..62052 - 969 WP_011251287.1 IS5 family transposase -
NR799_RS25660 (NR799_25660) 62199..62618 - 420 WP_011251286.1 helix-turn-helix domain-containing protein Antitoxin
NR799_RS25665 (NR799_25665) 62615..62926 - 312 WP_011251285.1 type II toxin-antitoxin system HigB family toxin Toxin
NR799_RS25670 (NR799_25670) 63131..63568 - 438 Protein_62 DDE-type integrase/transposase/recombinase -
NR799_RS25675 (NR799_25675) 63703..64400 + 698 WP_223175001.1 IS1-like element IS1A family transposase -
NR799_RS25680 (NR799_25680) 64402..64851 + 450 WP_011251283.1 thioredoxin fold domain-containing protein -
NR799_RS25685 (NR799_25685) 64868..65179 + 312 WP_011251282.1 hypothetical protein -
NR799_RS25690 (NR799_25690) 65193..65534 + 342 WP_011251281.1 hypothetical protein -
NR799_RS25695 (NR799_25695) 65594..66550 + 957 WP_011251280.1 DsbA family protein -
NR799_RS25700 (NR799_25700) 66975..67415 - 441 WP_011251275.1 hypothetical protein -
NR799_RS25705 (NR799_25705) 67421..67915 - 495 WP_011251274.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroB / iroC / iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 1..241781 241781
- inside IScluster/Tn - - 43396..69835 26439


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(22-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(85-138)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12346.12 Da        Isoelectric Point: 9.7248

>T253645 WP_011251285.1 NZ_CP102436:c62926-62615 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE

Download         Length: 312 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15377.46 Da        Isoelectric Point: 4.4420

>AT253645 WP_011251286.1 NZ_CP102436:c62618-62199 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7W3D9W1

Antitoxin

Source ID Structure

References