253641

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4466676..4467262 Replicon chromosome
Accession NZ_CP102435
Organism Klebsiella pneumoniae strain K194

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NR799_RS22175 Protein ID WP_002920800.1
Coordinates 4466676..4467044 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag NR799_RS22180 Protein ID WP_002920802.1
Coordinates 4467041..4467262 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NR799_RS22155 (NR799_22155) 4462179..4463249 - 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
NR799_RS22160 (NR799_22160) 4463251..4464096 - 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NR799_RS22165 (NR799_22165) 4464093..4464980 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NR799_RS22170 (NR799_22170) 4465087..4466403 - 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NR799_RS22175 (NR799_22175) 4466676..4467044 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NR799_RS22180 (NR799_22180) 4467041..4467262 - 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NR799_RS22185 (NR799_22185) 4467426..4468139 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NR799_RS22190 (NR799_22190) 4468141..4468908 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NR799_RS22195 (NR799_22195) 4468905..4470182 - 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
NR799_RS22200 (NR799_22200) 4470179..4471105 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4461442..4483357 21915


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T253641 WP_002920800.1 NZ_CP102435:c4467044-4466676 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT253641 WP_002920802.1 NZ_CP102435:c4467262-4467041 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References