Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 4466676..4467262 | Replicon | chromosome |
Accession | NZ_CP102435 | ||
Organism | Klebsiella pneumoniae strain K194 |
Toxin (Protein)
Gene name | doc | Uniprot ID | W8VD46 |
Locus tag | NR799_RS22175 | Protein ID | WP_002920800.1 |
Coordinates | 4466676..4467044 (-) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A0H3GZM4 |
Locus tag | NR799_RS22180 | Protein ID | WP_002920802.1 |
Coordinates | 4467041..4467262 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR799_RS22155 (NR799_22155) | 4462179..4463249 | - | 1071 | WP_002920787.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
NR799_RS22160 (NR799_22160) | 4463251..4464096 | - | 846 | WP_002920789.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
NR799_RS22165 (NR799_22165) | 4464093..4464980 | - | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
NR799_RS22170 (NR799_22170) | 4465087..4466403 | - | 1317 | WP_002920796.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
NR799_RS22175 (NR799_22175) | 4466676..4467044 | - | 369 | WP_002920800.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NR799_RS22180 (NR799_22180) | 4467041..4467262 | - | 222 | WP_002920802.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NR799_RS22185 (NR799_22185) | 4467426..4468139 | - | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
NR799_RS22190 (NR799_22190) | 4468141..4468908 | - | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
NR799_RS22195 (NR799_22195) | 4468905..4470182 | - | 1278 | WP_002920806.1 | branched chain amino acid ABC transporter permease LivM | - |
NR799_RS22200 (NR799_22200) | 4470179..4471105 | - | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 4461442..4483357 | 21915 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13552.92 Da Isoelectric Point: 8.6410
>T253641 WP_002920800.1 NZ_CP102435:c4467044-4466676 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GUD1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZM4 |