Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 4057443..4058218 | Replicon | chromosome |
| Accession | NZ_CP102435 | ||
| Organism | Klebsiella pneumoniae strain K194 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
| Locus tag | NR799_RS20035 | Protein ID | WP_004150910.1 |
| Coordinates | 4057443..4057928 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | W8UEW1 |
| Locus tag | NR799_RS20040 | Protein ID | WP_004150912.1 |
| Coordinates | 4057925..4058218 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NR799_RS20005 (NR799_20005) | 4052772..4053155 | - | 384 | WP_004150906.1 | hypothetical protein | - |
| NR799_RS20010 (NR799_20010) | 4053155..4054027 | - | 873 | WP_004188557.1 | ParA family protein | - |
| NR799_RS20015 (NR799_20015) | 4054633..4054849 | - | 217 | Protein_3923 | transposase | - |
| NR799_RS20020 (NR799_20020) | 4054946..4055035 | - | 90 | Protein_3924 | hypothetical protein | - |
| NR799_RS20025 (NR799_20025) | 4055185..4056165 | - | 981 | WP_000019445.1 | IS5-like element ISKpn26 family transposase | - |
| NR799_RS20030 (NR799_20030) | 4056230..4056739 | - | 510 | Protein_3926 | hypothetical protein | - |
| NR799_RS20035 (NR799_20035) | 4057443..4057928 | - | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
| NR799_RS20040 (NR799_20040) | 4057925..4058218 | - | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
| NR799_RS20045 (NR799_20045) | 4058863..4060239 | + | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
| NR799_RS20050 (NR799_20050) | 4060250..4061398 | + | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
| NR799_RS20055 (NR799_20055) | 4061399..4062310 | - | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
| NR799_RS20060 (NR799_20060) | 4062408..4063010 | + | 603 | WP_062954968.1 | short chain dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Integrative and Conjugative Element | - | - | 3994825..4058469 | 63644 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T253639 WP_004150910.1 NZ_CP102435:c4057928-4057443 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q4Q548 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GVL4 |