Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 134329..134582 Replicon plasmid pKPC-ESBL-2
Accession NZ_CP102392
Organism Klebsiella pneumoniae strain K64

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag NRF21_RS28390 Protein ID WP_001312851.1
Coordinates 134433..134582 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 134329..134388 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NRF21_RS28350 (129711) 129711..130055 - 345 Protein_164 IS6-like element IS26 family transposase -
NRF21_RS28355 (130107) 130107..130811 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
NRF21_RS28360 (130836) 130836..131036 + 201 WP_072354025.1 hypothetical protein -
NRF21_RS28365 (131056) 131056..131802 + 747 WP_000205770.1 conjugal transfer pilus acetylase TraX -
NRF21_RS28370 (131857) 131857..132417 + 561 WP_000139328.1 fertility inhibition protein FinO -
NRF21_RS28375 (132549) 132549..132749 + 201 WP_015059022.1 hypothetical protein -
NRF21_RS28380 (133135) 133135..133734 + 600 WP_032083981.1 PIN domain-containing protein -
NRF21_RS28385 (133796) 133796..134128 + 333 WP_152916585.1 hypothetical protein -
- (134329) 134329..134388 - 60 NuclAT_1 - Antitoxin
- (134329) 134329..134388 - 60 NuclAT_1 - Antitoxin
- (134329) 134329..134388 - 60 NuclAT_1 - Antitoxin
- (134329) 134329..134388 - 60 NuclAT_1 - Antitoxin
NRF21_RS28390 (134433) 134433..134582 + 150 WP_001312851.1 Hok/Gef family protein Toxin
NRF21_RS28395 (134866) 134866..135114 + 249 WP_000083837.1 replication regulatory protein RepA -
NRF21_RS28400 (135229) 135229..135413 + 185 Protein_174 protein CopA/IncA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 - 1..135425 135425


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T253621 WP_001312851.1 NZ_CP102392:134433-134582 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 60 bp

>AT253621 NZ_CP102392:c134388-134329 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References