Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 134329..134582 | Replicon | plasmid pKPC-ESBL-2 |
| Accession | NZ_CP102392 | ||
| Organism | Klebsiella pneumoniae strain K64 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NRF21_RS28390 | Protein ID | WP_001312851.1 |
| Coordinates | 134433..134582 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 134329..134388 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NRF21_RS28350 (129711) | 129711..130055 | - | 345 | Protein_164 | IS6-like element IS26 family transposase | - |
| NRF21_RS28355 (130107) | 130107..130811 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| NRF21_RS28360 (130836) | 130836..131036 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| NRF21_RS28365 (131056) | 131056..131802 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| NRF21_RS28370 (131857) | 131857..132417 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| NRF21_RS28375 (132549) | 132549..132749 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| NRF21_RS28380 (133135) | 133135..133734 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| NRF21_RS28385 (133796) | 133796..134128 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (134329) | 134329..134388 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (134329) | 134329..134388 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (134329) | 134329..134388 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (134329) | 134329..134388 | - | 60 | NuclAT_1 | - | Antitoxin |
| NRF21_RS28390 (134433) | 134433..134582 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NRF21_RS28395 (134866) | 134866..135114 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| NRF21_RS28400 (135229) | 135229..135413 | + | 185 | Protein_174 | protein CopA/IncA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..135425 | 135425 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T253621 WP_001312851.1 NZ_CP102392:134433-134582 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT253621 NZ_CP102392:c134388-134329 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
