Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 29460..29886 | Replicon | plasmid pKPC-ESBL-2 |
Accession | NZ_CP102392 | ||
Organism | Klebsiella pneumoniae strain K64 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | NRF21_RS27710 | Protein ID | WP_001372321.1 |
Coordinates | 29460..29585 (-) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 29662..29886 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NRF21_RS27680 (24728) | 24728..25432 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
NRF21_RS27685 (25713) | 25713..26096 | - | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
NRF21_RS27690 (26373) | 26373..27020 | + | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
NRF21_RS27695 (27317) | 27317..28138 | - | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
NRF21_RS27700 (28249) | 28249..28545 | - | 297 | WP_001272251.1 | hypothetical protein | - |
NRF21_RS27705 (28845) | 28845..29141 | + | 297 | Protein_35 | hypothetical protein | - |
NRF21_RS27710 (29460) | 29460..29585 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
NRF21_RS27715 (29527) | 29527..29676 | - | 150 | Protein_37 | plasmid maintenance protein Mok | - |
- (29662) | 29662..29886 | - | 225 | NuclAT_0 | - | Antitoxin |
- (29662) | 29662..29886 | - | 225 | NuclAT_0 | - | Antitoxin |
- (29662) | 29662..29886 | - | 225 | NuclAT_0 | - | Antitoxin |
- (29662) | 29662..29886 | - | 225 | NuclAT_0 | - | Antitoxin |
NRF21_RS27720 (29898) | 29898..30617 | - | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
NRF21_RS27725 (30614) | 30614..31048 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
NRF21_RS27730 (31117) | 31117..33140 | - | 2024 | Protein_40 | ParB/RepB/Spo0J family partition protein | - |
NRF21_RS27735 (33201) | 33201..33434 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
NRF21_RS27740 (33492) | 33492..34019 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
NRF21_RS27745 (34321) | 34321..34770 | + | 450 | Protein_43 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..135425 | 135425 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T253618 WP_001372321.1 NZ_CP102392:c29585-29460 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT253618 NZ_CP102392:c29886-29662 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|