Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 3037618..3038311 | Replicon | chromosome |
| Accession | NZ_CP102379 | ||
| Organism | Escherichia coli strain BM28 lysU | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | NR350_RS14770 | Protein ID | WP_000415584.1 |
| Coordinates | 3038015..3038311 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | NR350_RS14765 | Protein ID | WP_000650107.1 |
| Coordinates | 3037618..3038013 (-) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NR350_RS14755 (3033482) | 3033482..3035740 | - | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
| NR350_RS14760 (3035878) | 3035878..3037485 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
| NR350_RS14765 (3037618) | 3037618..3038013 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| NR350_RS14770 (3038015) | 3038015..3038311 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| NR350_RS14775 (3038516) | 3038516..3038998 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| NR350_RS14780 (3039051) | 3039051..3039443 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| NR350_RS14785 (3039595) | 3039595..3040254 | + | 660 | WP_001221495.1 | quorum sensing response regulator transcription factor QseB | - |
| NR350_RS14790 (3040251) | 3040251..3041600 | + | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
| NR350_RS14795 (3041646) | 3041646..3041978 | - | 333 | WP_000917684.1 | DUF2645 family protein | - |
| NR350_RS14800 (3042297) | 3042297..3042878 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| NR350_RS14805 (3042909) | 3042909..3043223 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T253552 WP_000415584.1 NZ_CP102379:c3038311-3038015 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT253552 WP_000650107.1 NZ_CP102379:c3038013-3037618 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|