Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3710616..3710838 | Replicon | chromosome |
| Accession | NZ_CP102378 | ||
| Organism | Escherichia coli strain JB41 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1E8T8 |
| Locus tag | NR351_RS18140 | Protein ID | WP_000141634.1 |
| Coordinates | 3710616..3710723 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3710772..3710838 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NR351_RS18115 | 3705869..3706597 | - | 729 | WP_011310329.1 | cellulose biosynthesis protein BcsQ | - |
| NR351_RS18120 | 3706633..3706821 | - | 189 | WP_001063318.1 | cellulose biosynthesis protein BcsR | - |
| NR351_RS18125 | 3707094..3708665 | + | 1572 | WP_001204931.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| NR351_RS18130 | 3708662..3708853 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| NR351_RS18135 | 3708850..3710529 | + | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
| NR351_RS18140 | 3710616..3710723 | - | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
| - | 3710772..3710838 | + | 67 | - | - | Antitoxin |
| NR351_RS18145 | 3711199..3712470 | + | 1272 | WP_001295225.1 | aromatic amino acid transport family protein | - |
| NR351_RS18150 | 3712500..3713504 | - | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| NR351_RS18155 | 3713501..3714484 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| NR351_RS18160 | 3714495..3715397 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T253520 WP_000141634.1 NZ_CP102378:c3710723-3710616 [Escherichia coli]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT253520 NZ_CP102378:3710772-3710838 [Escherichia coli]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|