Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 3178487..3179180 | Replicon | chromosome |
Accession | NZ_CP102378 | ||
Organism | Escherichia coli strain JB41 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | NR351_RS15535 | Protein ID | WP_000415584.1 |
Coordinates | 3178884..3179180 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | NR351_RS15530 | Protein ID | WP_000650107.1 |
Coordinates | 3178487..3178882 (-) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR351_RS15520 (3174351) | 3174351..3176609 | - | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
NR351_RS15525 (3176747) | 3176747..3178354 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
NR351_RS15530 (3178487) | 3178487..3178882 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
NR351_RS15535 (3178884) | 3178884..3179180 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
NR351_RS15540 (3179385) | 3179385..3179867 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
NR351_RS15545 (3179920) | 3179920..3180312 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
NR351_RS15550 (3180464) | 3180464..3181123 | + | 660 | WP_001221495.1 | quorum sensing response regulator transcription factor QseB | - |
NR351_RS15555 (3181120) | 3181120..3182469 | + | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
NR351_RS15560 (3182515) | 3182515..3182847 | - | 333 | WP_000917684.1 | DUF2645 family protein | - |
NR351_RS15565 (3183166) | 3183166..3183747 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
NR351_RS15570 (3183778) | 3183778..3184092 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T253517 WP_000415584.1 NZ_CP102378:c3179180-3178884 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT253517 WP_000650107.1 NZ_CP102378:c3178882-3178487 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|