Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1280874..1281096 Replicon chromosome
Accession NZ_CP102378
Organism Escherichia coli strain JB41

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag NR351_RS06315 Protein ID WP_000170955.1
Coordinates 1280874..1280981 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1281029..1281096 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NR351_RS06285 (1276730) 1276730..1277563 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
NR351_RS06290 (1277560) 1277560..1277952 + 393 WP_000200374.1 invasion regulator SirB2 -
NR351_RS06295 (1277956) 1277956..1278765 + 810 WP_001257044.1 invasion regulator SirB1 -
NR351_RS06300 (1278801) 1278801..1279655 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
NR351_RS06305 (1279804) 1279804..1279911 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1279959) 1279959..1280025 + 67 NuclAT_34 - -
- (1279959) 1279959..1280025 + 67 NuclAT_34 - -
- (1279959) 1279959..1280025 + 67 NuclAT_34 - -
- (1279959) 1279959..1280025 + 67 NuclAT_34 - -
- (1279959) 1279959..1280025 + 67 NuclAT_36 - -
- (1279959) 1279959..1280025 + 67 NuclAT_36 - -
- (1279959) 1279959..1280025 + 67 NuclAT_36 - -
- (1279959) 1279959..1280025 + 67 NuclAT_36 - -
- (1279959) 1279959..1280025 + 67 NuclAT_38 - -
- (1279959) 1279959..1280025 + 67 NuclAT_38 - -
- (1279959) 1279959..1280025 + 67 NuclAT_38 - -
- (1279959) 1279959..1280025 + 67 NuclAT_38 - -
- (1279959) 1279959..1280025 + 67 NuclAT_40 - -
- (1279959) 1279959..1280025 + 67 NuclAT_40 - -
- (1279959) 1279959..1280025 + 67 NuclAT_40 - -
- (1279959) 1279959..1280025 + 67 NuclAT_40 - -
- (1279959) 1279959..1280025 + 67 NuclAT_42 - -
- (1279959) 1279959..1280025 + 67 NuclAT_42 - -
- (1279959) 1279959..1280025 + 67 NuclAT_42 - -
- (1279959) 1279959..1280025 + 67 NuclAT_42 - -
- (1279959) 1279959..1280025 + 67 NuclAT_44 - -
- (1279959) 1279959..1280025 + 67 NuclAT_44 - -
- (1279959) 1279959..1280025 + 67 NuclAT_44 - -
- (1279959) 1279959..1280025 + 67 NuclAT_44 - -
- (1279961) 1279961..1280026 + 66 NuclAT_18 - -
- (1279961) 1279961..1280026 + 66 NuclAT_18 - -
- (1279961) 1279961..1280026 + 66 NuclAT_18 - -
- (1279961) 1279961..1280026 + 66 NuclAT_18 - -
- (1279961) 1279961..1280026 + 66 NuclAT_21 - -
- (1279961) 1279961..1280026 + 66 NuclAT_21 - -
- (1279961) 1279961..1280026 + 66 NuclAT_21 - -
- (1279961) 1279961..1280026 + 66 NuclAT_21 - -
- (1279961) 1279961..1280026 + 66 NuclAT_24 - -
- (1279961) 1279961..1280026 + 66 NuclAT_24 - -
- (1279961) 1279961..1280026 + 66 NuclAT_24 - -
- (1279961) 1279961..1280026 + 66 NuclAT_24 - -
- (1279961) 1279961..1280026 + 66 NuclAT_27 - -
- (1279961) 1279961..1280026 + 66 NuclAT_27 - -
- (1279961) 1279961..1280026 + 66 NuclAT_27 - -
- (1279961) 1279961..1280026 + 66 NuclAT_27 - -
- (1279961) 1279961..1280026 + 66 NuclAT_30 - -
- (1279961) 1279961..1280026 + 66 NuclAT_30 - -
- (1279961) 1279961..1280026 + 66 NuclAT_30 - -
- (1279961) 1279961..1280026 + 66 NuclAT_30 - -
- (1279961) 1279961..1280026 + 66 NuclAT_33 - -
- (1279961) 1279961..1280026 + 66 NuclAT_33 - -
- (1279961) 1279961..1280026 + 66 NuclAT_33 - -
- (1279961) 1279961..1280026 + 66 NuclAT_33 - -
NR351_RS06310 (1280339) 1280339..1280446 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1280495) 1280495..1280560 + 66 NuclAT_35 - -
- (1280495) 1280495..1280560 + 66 NuclAT_35 - -
- (1280495) 1280495..1280560 + 66 NuclAT_35 - -
- (1280495) 1280495..1280560 + 66 NuclAT_35 - -
- (1280495) 1280495..1280560 + 66 NuclAT_37 - -
- (1280495) 1280495..1280560 + 66 NuclAT_37 - -
- (1280495) 1280495..1280560 + 66 NuclAT_37 - -
- (1280495) 1280495..1280560 + 66 NuclAT_37 - -
- (1280495) 1280495..1280560 + 66 NuclAT_39 - -
- (1280495) 1280495..1280560 + 66 NuclAT_39 - -
- (1280495) 1280495..1280560 + 66 NuclAT_39 - -
- (1280495) 1280495..1280560 + 66 NuclAT_39 - -
- (1280495) 1280495..1280560 + 66 NuclAT_41 - -
- (1280495) 1280495..1280560 + 66 NuclAT_41 - -
- (1280495) 1280495..1280560 + 66 NuclAT_41 - -
- (1280495) 1280495..1280560 + 66 NuclAT_41 - -
- (1280495) 1280495..1280560 + 66 NuclAT_43 - -
- (1280495) 1280495..1280560 + 66 NuclAT_43 - -
- (1280495) 1280495..1280560 + 66 NuclAT_43 - -
- (1280495) 1280495..1280560 + 66 NuclAT_43 - -
- (1280495) 1280495..1280560 + 66 NuclAT_45 - -
- (1280495) 1280495..1280560 + 66 NuclAT_45 - -
- (1280495) 1280495..1280560 + 66 NuclAT_45 - -
- (1280495) 1280495..1280560 + 66 NuclAT_45 - -
- (1280494) 1280494..1280561 + 68 NuclAT_17 - -
- (1280494) 1280494..1280561 + 68 NuclAT_17 - -
- (1280494) 1280494..1280561 + 68 NuclAT_17 - -
- (1280494) 1280494..1280561 + 68 NuclAT_17 - -
- (1280494) 1280494..1280561 + 68 NuclAT_20 - -
- (1280494) 1280494..1280561 + 68 NuclAT_20 - -
- (1280494) 1280494..1280561 + 68 NuclAT_20 - -
- (1280494) 1280494..1280561 + 68 NuclAT_20 - -
- (1280494) 1280494..1280561 + 68 NuclAT_23 - -
- (1280494) 1280494..1280561 + 68 NuclAT_23 - -
- (1280494) 1280494..1280561 + 68 NuclAT_23 - -
- (1280494) 1280494..1280561 + 68 NuclAT_23 - -
- (1280494) 1280494..1280561 + 68 NuclAT_26 - -
- (1280494) 1280494..1280561 + 68 NuclAT_26 - -
- (1280494) 1280494..1280561 + 68 NuclAT_26 - -
- (1280494) 1280494..1280561 + 68 NuclAT_26 - -
- (1280494) 1280494..1280561 + 68 NuclAT_29 - -
- (1280494) 1280494..1280561 + 68 NuclAT_29 - -
- (1280494) 1280494..1280561 + 68 NuclAT_29 - -
- (1280494) 1280494..1280561 + 68 NuclAT_29 - -
- (1280494) 1280494..1280561 + 68 NuclAT_32 - -
- (1280494) 1280494..1280561 + 68 NuclAT_32 - -
- (1280494) 1280494..1280561 + 68 NuclAT_32 - -
- (1280494) 1280494..1280561 + 68 NuclAT_32 - -
NR351_RS06315 (1280874) 1280874..1280981 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1281029) 1281029..1281096 + 68 NuclAT_16 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_16 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_16 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_16 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_19 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_19 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_19 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_19 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_22 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_22 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_22 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_22 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_25 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_25 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_25 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_25 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_28 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_28 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_28 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_28 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_31 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_31 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_31 - Antitoxin
- (1281029) 1281029..1281096 + 68 NuclAT_31 - Antitoxin
NR351_RS06320 (1281385) 1281385..1282485 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
NR351_RS06325 (1282755) 1282755..1282985 + 231 WP_001146444.1 putative cation transport regulator ChaB -
NR351_RS06330 (1283143) 1283143..1283838 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
NR351_RS06335 (1283882) 1283882..1284235 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
NR351_RS06340 (1284420) 1284420..1285814 + 1395 WP_000086217.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T253498 WP_000170955.1 NZ_CP102378:c1280981-1280874 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 68 bp

>AT253498 NZ_CP102378:1281029-1281096 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829J2A9

Antitoxin

Download structure file

References