Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1280339..1280561 | Replicon | chromosome |
Accession | NZ_CP102378 | ||
Organism | Escherichia coli strain JB41 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | J7R083 |
Locus tag | NR351_RS06310 | Protein ID | WP_000170963.1 |
Coordinates | 1280339..1280446 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1280494..1280561 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR351_RS06280 (1275648) | 1275648..1276730 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
NR351_RS06285 (1276730) | 1276730..1277563 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
NR351_RS06290 (1277560) | 1277560..1277952 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
NR351_RS06295 (1277956) | 1277956..1278765 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
NR351_RS06300 (1278801) | 1278801..1279655 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
NR351_RS06305 (1279804) | 1279804..1279911 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_34 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_34 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_34 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_34 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_36 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_36 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_36 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_36 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_38 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_38 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_38 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_38 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_40 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_40 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_40 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_40 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_42 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_42 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_42 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_42 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_44 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_44 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_44 | - | - |
- (1279959) | 1279959..1280025 | + | 67 | NuclAT_44 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_18 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_18 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_18 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_18 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_21 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_21 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_21 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_21 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_24 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_24 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_24 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_24 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_27 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_27 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_27 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_27 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_30 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_30 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_30 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_30 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_33 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_33 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_33 | - | - |
- (1279961) | 1279961..1280026 | + | 66 | NuclAT_33 | - | - |
NR351_RS06310 (1280339) | 1280339..1280446 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_35 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_35 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_35 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_35 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_37 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_37 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_37 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_37 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_39 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_39 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_39 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_39 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_41 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_41 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_41 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_41 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_43 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_43 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_43 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_43 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_45 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_45 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_45 | - | - |
- (1280495) | 1280495..1280560 | + | 66 | NuclAT_45 | - | - |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_17 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_17 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_17 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_17 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_20 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_20 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_20 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_20 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_23 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_23 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_23 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_23 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_26 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_26 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_26 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_26 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_29 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_29 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_29 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_29 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_32 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_32 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_32 | - | Antitoxin |
- (1280494) | 1280494..1280561 | + | 68 | NuclAT_32 | - | Antitoxin |
NR351_RS06315 (1280874) | 1280874..1280981 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_16 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_16 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_16 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_16 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_19 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_19 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_19 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_19 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_22 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_22 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_22 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_22 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_25 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_25 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_25 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_25 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_28 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_28 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_28 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_28 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_31 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_31 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_31 | - | - |
- (1281029) | 1281029..1281096 | + | 68 | NuclAT_31 | - | - |
NR351_RS06320 (1281385) | 1281385..1282485 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
NR351_RS06325 (1282755) | 1282755..1282985 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
NR351_RS06330 (1283143) | 1283143..1283838 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
NR351_RS06335 (1283882) | 1283882..1284235 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T253495 WP_000170963.1 NZ_CP102378:c1280446-1280339 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 68 bp
>AT253495 NZ_CP102378:1280494-1280561 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|