Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 6779600..6780254 | Replicon | chromosome |
Accession | NZ_CP102374 | ||
Organism | Pseudomonas sp. T8 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NRG23_RS30785 | Protein ID | WP_038636757.1 |
Coordinates | 6779904..6780254 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NRG23_RS30780 | Protein ID | WP_009049793.1 |
Coordinates | 6779600..6779914 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NRG23_RS30760 (NRG23_30760) | 6775567..6776433 | + | 867 | WP_009049796.1 | sugar ABC transporter permease | - |
NRG23_RS30765 (NRG23_30765) | 6776445..6777245 | + | 801 | WP_007929618.1 | carbohydrate ABC transporter permease | - |
NRG23_RS30770 (NRG23_30770) | 6777256..6777528 | + | 273 | WP_009049795.1 | DUF2160 domain-containing protein | - |
NRG23_RS30775 (NRG23_30775) | 6777692..6779434 | + | 1743 | WP_257373220.1 | ABC transporter substrate-binding protein | - |
NRG23_RS30780 (NRG23_30780) | 6779600..6779914 | - | 315 | WP_009049793.1 | transcriptional regulator | Antitoxin |
NRG23_RS30785 (NRG23_30785) | 6779904..6780254 | - | 351 | WP_038636757.1 | toxin | Toxin |
NRG23_RS30790 (NRG23_30790) | 6780501..6781964 | - | 1464 | WP_007929613.1 | NADH-quinone oxidoreductase subunit NuoN | - |
NRG23_RS30795 (NRG23_30795) | 6781972..6783504 | - | 1533 | WP_009049790.1 | NADH-quinone oxidoreductase subunit M | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13987.96 Da Isoelectric Point: 9.4183
>T253490 WP_038636757.1 NZ_CP102374:c6780254-6779904 [Pseudomonas sp. T8]
MGALFIELPPFQRHRQDYLDDELFRNLQLELLKAPEAGDLIERTDGLRKIRFVDERRHKGKRGGIRVIYYWWSGDAQFWL
FTLYAKNEQNDLTPHQKKLLKQLLNREVEARTHHET
MGALFIELPPFQRHRQDYLDDELFRNLQLELLKAPEAGDLIERTDGLRKIRFVDERRHKGKRGGIRVIYYWWSGDAQFWL
FTLYAKNEQNDLTPHQKKLLKQLLNREVEARTHHET
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|