Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3751712..3752406 | Replicon | chromosome |
Accession | NZ_CP102374 | ||
Organism | Pseudomonas sp. T8 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NRG23_RS16800 | Protein ID | WP_053268076.1 |
Coordinates | 3752110..3752406 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A554PLA7 |
Locus tag | NRG23_RS16795 | Protein ID | WP_009046631.1 |
Coordinates | 3751712..3752113 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NRG23_RS16785 (NRG23_16785) | 3746846..3750196 | + | 3351 | WP_009046633.1 | mechanosensitive channel MscK | - |
NRG23_RS16790 (NRG23_16790) | 3750245..3751708 | + | 1464 | WP_103330901.1 | YdiU family protein | - |
NRG23_RS16795 (NRG23_16795) | 3751712..3752113 | - | 402 | WP_009046631.1 | transcriptional regulator | Antitoxin |
NRG23_RS16800 (NRG23_16800) | 3752110..3752406 | - | 297 | WP_053268076.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
NRG23_RS16805 (NRG23_16805) | 3752646..3753080 | + | 435 | WP_016704469.1 | thioredoxin TrxC | - |
NRG23_RS16810 (NRG23_16810) | 3753206..3753976 | - | 771 | WP_257371442.1 | ParA family protein | - |
NRG23_RS16815 (NRG23_16815) | 3754310..3755041 | + | 732 | WP_036985559.1 | beta-ketoacyl synthase chain length factor | - |
NRG23_RS16820 (NRG23_16820) | 3755017..3755832 | + | 816 | WP_016704468.1 | lysophospholipid acyltransferase family protein | - |
NRG23_RS16825 (NRG23_16825) | 3755807..3756067 | + | 261 | WP_007926834.1 | phosphopantetheine-binding protein | - |
NRG23_RS16830 (NRG23_16830) | 3756077..3756331 | + | 255 | WP_007926835.1 | acyl carrier protein | - |
NRG23_RS16835 (NRG23_16835) | 3756328..3756873 | + | 546 | WP_009046626.1 | membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11588.41 Da Isoelectric Point: 10.6515
>T253485 WP_053268076.1 NZ_CP102374:c3752406-3752110 [Pseudomonas sp. T8]
MHIITAKRIWEAKSRWPQSANALETWYRKVKSLNPADFAAIKAVFPATDKVGAFHVFDIGGNKLRIIAVVRYEVRRLYIR
HVLDHHEYDKGRWKEETR
MHIITAKRIWEAKSRWPQSANALETWYRKVKSLNPADFAAIKAVFPATDKVGAFHVFDIGGNKLRIIAVVRYEVRRLYIR
HVLDHHEYDKGRWKEETR
Download Length: 297 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14840.85 Da Isoelectric Point: 4.4394
>AT253485 WP_009046631.1 NZ_CP102374:c3752113-3751712 [Pseudomonas sp. T8]
MNVLVKQAADHWHFVAPVLRKPNTEADYDALVAALDELLDLMGEDENHPVTSLVDIIGDWIEAYDEEHRPMPIASGVDVL
RSLMREHGLTQSDLPGVGAQSVVSEVLSGKRQLNLRQIRWLAERFGVSAEVFI
MNVLVKQAADHWHFVAPVLRKPNTEADYDALVAALDELLDLMGEDENHPVTSLVDIIGDWIEAYDEEHRPMPIASGVDVL
RSLMREHGLTQSDLPGVGAQSVVSEVLSGKRQLNLRQIRWLAERFGVSAEVFI
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|