Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/- |
| Location | 4339272..4339926 | Replicon | chromosome |
| Accession | NZ_CP102358 | ||
| Organism | Pseudomonas zeae strain BIM B-582 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NQ186_RS19255 | Protein ID | WP_116256087.1 |
| Coordinates | 4339272..4339622 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NQ186_RS19260 | Protein ID | WP_027614657.1 |
| Coordinates | 4339612..4339926 (+) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ186_RS19245 (NQ186_19245) | 4335819..4337351 | + | 1533 | WP_077573624.1 | NADH-quinone oxidoreductase subunit M | - |
| NQ186_RS19250 (NQ186_19250) | 4337359..4338822 | + | 1464 | WP_008082842.1 | NADH-quinone oxidoreductase subunit NuoN | - |
| NQ186_RS19255 (NQ186_19255) | 4339272..4339622 | + | 351 | WP_116256087.1 | toxin | Toxin |
| NQ186_RS19260 (NQ186_19260) | 4339612..4339926 | + | 315 | WP_027614657.1 | transcriptional regulator | Antitoxin |
| NQ186_RS19265 (NQ186_19265) | 4340100..4341425 | + | 1326 | WP_257355518.1 | OprD family porin | - |
| NQ186_RS19270 (NQ186_19270) | 4341584..4342105 | - | 522 | WP_093434262.1 | hypothetical protein | - |
| NQ186_RS19275 (NQ186_19275) | 4342063..4342353 | - | 291 | WP_041073246.1 | DUF1778 domain-containing protein | - |
| NQ186_RS19280 (NQ186_19280) | 4342643..4343023 | - | 381 | WP_099756649.1 | DUF6124 family protein | - |
| NQ186_RS19285 (NQ186_19285) | 4343433..4343765 | - | 333 | WP_116256076.1 | DUF2790 domain-containing protein | - |
| NQ186_RS19290 (NQ186_19290) | 4343843..4344046 | - | 204 | WP_257355520.1 | co-regulatory protein PtrA N-terminal domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13994.81 Da Isoelectric Point: 7.2021
>T253476 WP_116256087.1 NZ_CP102358:4339272-4339622 [Pseudomonas zeae]
MDALFIELPVFQKHRDDYLDDDLFRSFQLELLKNPEAGDLIEDTGGLRKIRFGDQRRGKGKRSGLRVIYYWWSGFDQFWL
FTVYNKNEQDDLTPAQKKLFRKTLDRELNVRTHYET
MDALFIELPVFQKHRDDYLDDDLFRSFQLELLKNPEAGDLIEDTGGLRKIRFGDQRRGKGKRSGLRVIYYWWSGFDQFWL
FTVYNKNEQDDLTPAQKKLFRKTLDRELNVRTHYET
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|