Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | III | Classification (family/domain) | cptIN/- |
Location | 113306..113892 | Replicon | chromosome |
Accession | NZ_CP102292 | ||
Organism | [Ruminococcus] lactaris ATCC 29176 |
Toxin (Protein)
Gene name | cptN | Uniprot ID | B5CQ38 |
Locus tag | NQ541_RS00605 | Protein ID | WP_005611427.1 |
Coordinates | 113306..113794 (-) | Length | 163 a.a. |
Antitoxin (RNA)
Gene name | cptI | ||
Locus tag | - | ||
Coordinates | 113847..113892 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQ541_RS00575 (NQ541_00575) | 108729..109121 | + | 393 | WP_005611436.1 | VOC family protein | - |
NQ541_RS00580 (NQ541_00580) | 109140..110504 | + | 1365 | WP_005611433.1 | MFS transporter | - |
NQ541_RS00585 (NQ541_00585) | 110488..111450 | + | 963 | WP_005611430.1 | carbohydrate kinase | - |
NQ541_RS00590 (NQ541_00590) | 111602..111922 | - | 321 | WP_005611429.1 | tetratricopeptide repeat protein | - |
NQ541_RS00595 (NQ541_00595) | 111894..112880 | - | 987 | WP_005611428.1 | ATP-binding protein | - |
NQ541_RS00600 (NQ541_00600) | 113132..113266 | + | 135 | WP_004844681.1 | hypothetical protein | - |
NQ541_RS00605 (NQ541_00605) | 113306..113794 | - | 489 | WP_005611427.1 | hypothetical protein | Toxin |
- | 113847..113892 | - | 46 | - | - | Antitoxin |
NQ541_RS00610 (NQ541_00610) | 114083..115768 | + | 1686 | WP_005611426.1 | recombinase family protein | - |
NQ541_RS00615 (NQ541_00615) | 115934..116173 | + | 240 | Protein_118 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
NQ541_RS00620 (NQ541_00620) | 116175..116582 | + | 408 | WP_005611419.1 | hypothetical protein | - |
NQ541_RS00625 (NQ541_00625) | 116980..117615 | + | 636 | WP_005611417.1 | zinc ribbon domain-containing protein | - |
NQ541_RS00630 (NQ541_00630) | 117771..117995 | + | 225 | WP_005611413.1 | helix-turn-helix transcriptional regulator | - |
NQ541_RS00635 (NQ541_00635) | 118008..118712 | + | 705 | WP_005611411.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 163 a.a. Molecular weight: 19149.11 Da Isoelectric Point: 9.1905
>T253414 WP_005611427.1 NZ_CP102292:c113794-113306 [[Ruminococcus] lactaris ATCC 29176]
MIYQEGYVYHIKDEYFEKVQDSNLMQNKEGGTYRLTFYCLRDNKTSLLWMVPLSSRVEKFKAIHDKQVAKYGKCLTIVLG
EFDGKEAAFLLQNMFPIRDYYLDHIHTRNNNPVPVKHSIHREVTTHMKKIRQLHSRGKKVVFPDIDRLEQIMLAEVKDNA
AE
MIYQEGYVYHIKDEYFEKVQDSNLMQNKEGGTYRLTFYCLRDNKTSLLWMVPLSSRVEKFKAIHDKQVAKYGKCLTIVLG
EFDGKEAAFLLQNMFPIRDYYLDHIHTRNNNPVPVKHSIHREVTTHMKKIRQLHSRGKKVVFPDIDRLEQIMLAEVKDNA
AE
Download Length: 489 bp
Antitoxin
Download Length: 46 bp
>AT253414 NZ_CP102292:c113892-113847 [[Ruminococcus] lactaris ATCC 29176]
TCGAAAATATTGTTCGCTCACCGGAAGCGTCTAATAAATGTCCGGC
TCGAAAATATTGTTCGCTCACCGGAAGCGTCTAATAAATGTCCGGC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|