Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | III | Classification (family/domain) | cptIN/- |
Location | 2846697..2847283 | Replicon | chromosome |
Accession | NZ_CP102282 | ||
Organism | Eubacterium ventriosum strain ATCC 27560 |
Toxin (Protein)
Gene name | cptN | Uniprot ID | A5Z5E0 |
Locus tag | NQ558_RS13085 | Protein ID | WP_005362306.1 |
Coordinates | 2846795..2847283 (+) | Length | 163 a.a. |
Antitoxin (RNA)
Gene name | cptI | ||
Locus tag | - | ||
Coordinates | 2846697..2846742 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQ558_RS13065 (2842536) | 2842536..2842910 | - | 375 | WP_005362296.1 | hypothetical protein | - |
NQ558_RS13070 (2842928) | 2842928..2843620 | - | 693 | WP_005362298.1 | DUF4405 domain-containing protein | - |
NQ558_RS13075 (2843779) | 2843779..2844669 | - | 891 | WP_005362300.1 | LysR family transcriptional regulator | - |
NQ558_RS13080 (2844713) | 2844713..2846506 | - | 1794 | WP_005362302.1 | recombinase family protein | - |
- (2846697) | 2846697..2846742 | + | 46 | NuclAT_0 | - | Antitoxin |
- (2846697) | 2846697..2846742 | + | 46 | NuclAT_0 | - | Antitoxin |
NQ558_RS13085 (2846795) | 2846795..2847283 | + | 489 | WP_005362306.1 | type III toxin-antitoxin system ToxN/AbiQ family toxin | Toxin |
NQ558_RS13090 (2847323) | 2847323..2847457 | - | 135 | WP_004844681.1 | hypothetical protein | - |
NQ558_RS13095 (2847708) | 2847708..2849954 | + | 2247 | WP_005362309.1 | tetratricopeptide repeat protein | - |
NQ558_RS13100 (2849992) | 2849992..2850864 | - | 873 | WP_005362311.1 | ATP-binding cassette domain-containing protein | - |
NQ558_RS13105 (2850868) | 2850868..2851524 | - | 657 | WP_242652140.1 | transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 163 a.a. Molecular weight: 19191.15 Da Isoelectric Point: 9.4265
>T253412 WP_005362306.1 NZ_CP102282:2846795-2847283 [Eubacterium ventriosum]
MIYQEGYVYHIKDEYFEKVRDSNLMQNKEGGTYRPTFYCLRDNKTSLLWMVPLSSRVEKFKAIHDKQVAKYGKCLTIVLG
EFDGKEAAFLLQNMFPIRDYYLDHIHTRNNNPVPVKHSIHREVTTHMKKIRQLHSRGKKVVFPDIDRLEQIMLAEVKDNA
TE
MIYQEGYVYHIKDEYFEKVRDSNLMQNKEGGTYRPTFYCLRDNKTSLLWMVPLSSRVEKFKAIHDKQVAKYGKCLTIVLG
EFDGKEAAFLLQNMFPIRDYYLDHIHTRNNNPVPVKHSIHREVTTHMKKIRQLHSRGKKVVFPDIDRLEQIMLAEVKDNA
TE
Download Length: 489 bp
Antitoxin
Download Length: 46 bp
>AT253412 NZ_CP102282:2846697-2846742 [Eubacterium ventriosum]
TCGAAAATATTGTTCGCTCACCGGAAGCGTCTAATAAATGTCCGGC
TCGAAAATATTGTTCGCTCACCGGAAGCGTCTAATAAATGTCCGGC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|