Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | III | Classification (family/domain) | cptIN/- |
Location | 6549601..6550193 | Replicon | chromosome |
Accession | NZ_CP102274 | ||
Organism | Hungatella hathewayi strain DSM 13479 |
Toxin (Protein)
Gene name | cptN | Uniprot ID | A0A174X7X3 |
Locus tag | NQ487_RS29905 | Protein ID | WP_055651970.1 |
Coordinates | 6549708..6550193 (+) | Length | 162 a.a. |
Antitoxin (RNA)
Gene name | cptI | ||
Locus tag | - | ||
Coordinates | 6549601..6549647 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQ487_RS29890 (6544916) | 6544916..6545872 | - | 957 | WP_006774117.1 | ABC transporter permease | - |
NQ487_RS29895 (6546191) | 6546191..6548797 | - | 2607 | WP_006774114.1 | cation-translocating P-type ATPase | - |
NQ487_RS29900 (6548958) | 6548958..6549440 | + | 483 | WP_118041670.1 | S-ribosylhomocysteine lyase | - |
- (6549601) | 6549601..6549647 | + | 47 | NuclAT_0 | - | Antitoxin |
- (6549601) | 6549601..6549647 | + | 47 | NuclAT_0 | - | Antitoxin |
NQ487_RS29905 (6549708) | 6549708..6550193 | + | 486 | WP_055651970.1 | hypothetical protein | Toxin |
NQ487_RS29910 (6550257) | 6550257..6552128 | - | 1872 | WP_259952372.1 | alpha amylase C-terminal domain-containing protein | - |
NQ487_RS29915 (6552220) | 6552220..6554073 | - | 1854 | WP_118076947.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
NQ487_RS29920 (6554148) | 6554148..6554903 | - | 756 | WP_006774874.1 | exodeoxyribonuclease III | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 19009.00 Da Isoelectric Point: 8.9750
>T253409 WP_055651970.1 NZ_CP102274:6549708-6550193 [Hungatella hathewayi]
MDKGHFYYINDQYFIDFPDTMLMKNKETISGQPHDRPCFYAFEDQRTGLYWLIPFSSQVAKYRRYYNTKLQKYKCCDTIT
FGEVLGREKAFLIQNMCPVTNYYIKNEYIDSVSNIPVQVNGAFERELLQKAKRVLALQRKGIKLILPDVLSIEAQLLNKH
P
MDKGHFYYINDQYFIDFPDTMLMKNKETISGQPHDRPCFYAFEDQRTGLYWLIPFSSQVAKYRRYYNTKLQKYKCCDTIT
FGEVLGREKAFLIQNMCPVTNYYIKNEYIDSVSNIPVQVNGAFERELLQKAKRVLALQRKGIKLILPDVLSIEAQLLNKH
P
Download Length: 486 bp
Antitoxin
Download Length: 47 bp
>AT253409 NZ_CP102274:6549601-6549647 [Hungatella hathewayi]
CAAATGTTTGTCGCTACTCGATATGCGACTCATCAAAAGGTCGAGTT
CAAATGTTTGTCGCTACTCGATATGCGACTCATCAAAAGGTCGAGTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|