Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | III | Classification (family/domain) | cptIN/- |
Location | 3071265..3071665 | Replicon | chromosome |
Accession | NZ_CP102268 | ||
Organism | Marvinbryantia formatexigens DSM 14469 |
Toxin (Protein)
Gene name | cptN | Uniprot ID | - |
Locus tag | NQ534_RS14420 | Protein ID | WP_006863777.1 |
Coordinates | 3071411..3071665 (+) | Length | 85 a.a. |
Antitoxin (RNA)
Gene name | cptI | ||
Locus tag | - | ||
Coordinates | 3071265..3071308 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQ534_RS14395 (3067203) | 3067203..3067580 | + | 378 | WP_006863771.1 | hypothetical protein | - |
NQ534_RS14400 (3067682) | 3067682..3068662 | + | 981 | WP_040784889.1 | AAA family ATPase | - |
NQ534_RS14405 (3068982) | 3068982..3070331 | + | 1350 | WP_006863774.1 | plasmid recombination protein | - |
NQ534_RS14410 (3070346) | 3070346..3070660 | + | 315 | WP_176944209.1 | hypothetical protein | - |
NQ534_RS14415 (3070766) | 3070766..3071218 | + | 453 | WP_040784854.1 | hypothetical protein | - |
- (3071265) | 3071265..3071308 | + | 44 | NuclAT_0 | - | Antitoxin |
- (3071265) | 3071265..3071308 | + | 44 | NuclAT_0 | - | Antitoxin |
- (3071265) | 3071265..3071308 | + | 44 | NuclAT_0 | - | Antitoxin |
- (3071265) | 3071265..3071308 | + | 44 | NuclAT_0 | - | Antitoxin |
NQ534_RS14420 (3071411) | 3071411..3071665 | + | 255 | WP_006863777.1 | hypothetical protein | Toxin |
NQ534_RS14425 (3071674) | 3071674..3071874 | + | 201 | WP_006863778.1 | hypothetical protein | - |
NQ534_RS14430 (3072289) | 3072289..3072705 | + | 417 | WP_006863779.1 | YjdF family protein | - |
NQ534_RS14435 (3072786) | 3072786..3073292 | + | 507 | WP_006863780.1 | hypothetical protein | - |
NQ534_RS14440 (3073585) | 3073585..3074097 | + | 513 | WP_006863782.1 | RNA polymerase sigma factor | - |
NQ534_RS14445 (3074100) | 3074100..3074855 | + | 756 | WP_040784856.1 | hypothetical protein | - |
NQ534_RS14450 (3075098) | 3075098..3075319 | + | 222 | Protein_2842 | ATP-binding cassette domain-containing protein | - |
NQ534_RS14455 (3075294) | 3075294..3076103 | + | 810 | WP_242655406.1 | ABC transporter permease | - |
NQ534_RS14460 (3076022) | 3076022..3076402 | + | 381 | WP_143115847.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | clpP / tufA | 2787996..3112551 | 324555 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 9997.53 Da Isoelectric Point: 10.0456
>T253404 WP_006863777.1 NZ_CP102268:3071411-3071665 [Marvinbryantia formatexigens DSM 14469]
MKKTGFYIIKDKFFEDMPDPYLKGNRAGNRPHYYCFEDTSTGIYWMIPLSSRIDKYRRIMEKKPGNLATFFISSNWTTAG
RVHF
MKKTGFYIIKDKFFEDMPDPYLKGNRAGNRPHYYCFEDTSTGIYWMIPLSSRIDKYRRIMEKKPGNLATFFISSNWTTAG
RVHF
Download Length: 255 bp
Antitoxin
Download Length: 44 bp
>AT253404 NZ_CP102268:3071265-3071308 [Marvinbryantia formatexigens DSM 14469]
GAAGGTCTACCACTGACCGATATGTGGTATATAAATGGTCGGGT
GAAGGTCTACCACTGACCGATATGTGGTATATAAATGGTCGGGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|