Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4858249..4858851 | Replicon | chromosome |
| Accession | NZ_CP102244 | ||
| Organism | Escherichia coli O7:H15 strain ST70 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NQZ80_RS23115 | Protein ID | WP_024046152.1 |
| Coordinates | 4858540..4858851 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NQZ80_RS23110 | Protein ID | WP_000356395.1 |
| Coordinates | 4858249..4858539 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQZ80_RS23075 (4853873) | 4853873..4854775 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| NQZ80_RS23080 (4854772) | 4854772..4855407 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NQZ80_RS23085 (4855404) | 4855404..4856333 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| NQZ80_RS23090 (4856515) | 4856515..4856757 | - | 243 | WP_001309881.1 | CopG family transcriptional regulator | - |
| NQZ80_RS23095 (4856976) | 4856976..4857194 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| NQZ80_RS23100 (4857613) | 4857613..4857891 | - | 279 | WP_001315112.1 | hypothetical protein | - |
| NQZ80_RS23105 (4857943) | 4857943..4858164 | - | 222 | WP_001550354.1 | hypothetical protein | - |
| NQZ80_RS23110 (4858249) | 4858249..4858539 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
| NQZ80_RS23115 (4858540) | 4858540..4858851 | - | 312 | WP_024046152.1 | hypothetical protein | Toxin |
| NQZ80_RS23120 (4859080) | 4859080..4859988 | + | 909 | WP_001550353.1 | alpha/beta hydrolase | - |
| NQZ80_RS23125 (4860156) | 4860156..4861070 | - | 915 | WP_198443813.1 | transposase | - |
| NQZ80_RS23130 (4861083) | 4861083..4861970 | - | 888 | Protein_4521 | hypothetical protein | - |
| NQZ80_RS23135 (4862386) | 4862386..4863327 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| NQZ80_RS23140 (4863372) | 4863372..4863809 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12130.16 Da Isoelectric Point: 9.5486
>T253372 WP_024046152.1 NZ_CP102244:c4858851-4858540 [Escherichia coli O7:H15]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHCEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHCEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|