Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3961626..3962320 Replicon chromosome
Accession NZ_CP102244
Organism Escherichia coli O7:H15 strain ST70

Toxin (Protein)


Gene name yafO Uniprot ID A0A0D8WHS4
Locus tag NQZ80_RS18990 Protein ID WP_001521903.1
Coordinates 3961626..3962024 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1QAE3
Locus tag NQZ80_RS18995 Protein ID WP_000554758.1
Coordinates 3962027..3962320 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3957456) 3957456..3957536 - 81 NuclAT_9 - -
- (3957456) 3957456..3957536 - 81 NuclAT_9 - -
- (3957456) 3957456..3957536 - 81 NuclAT_9 - -
- (3957456) 3957456..3957536 - 81 NuclAT_9 - -
NQZ80_RS18960 (3956796) 3956796..3958040 - 1245 WP_000189541.1 esterase FrsA -
NQZ80_RS18965 (3958132) 3958132..3958590 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
NQZ80_RS18970 (3958851) 3958851..3960308 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
NQZ80_RS18975 (3960365) 3960365..3960717 - 353 Protein_3717 peptide chain release factor H -
NQZ80_RS18980 (3960713) 3960713..3960919 - 207 Protein_3718 RtcB family protein -
NQZ80_RS18985 (3961164) 3961164..3961616 - 453 WP_001059899.1 GNAT family N-acetyltransferase -
NQZ80_RS18990 (3961626) 3961626..3962024 - 399 WP_001521903.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
NQZ80_RS18995 (3962027) 3962027..3962320 - 294 WP_000554758.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
NQZ80_RS19000 (3962372) 3962372..3963427 - 1056 WP_001226166.1 DNA polymerase IV -
NQZ80_RS19005 (3963498) 3963498..3964420 - 923 Protein_3723 putative lateral flagellar export/assembly protein LafU -
NQZ80_RS19010 (3964423) 3964423..3965286 - 864 WP_001169518.1 flagellar motor stator protein MotA -
NQZ80_RS19015 (3965299) 3965299..3966018 - 720 WP_024042305.1 FliA/WhiG family RNA polymerase sigma factor -
NQZ80_RS19020 (3966038) 3966038..3966505 - 468 WP_000725257.1 flagellar basal body-associated FliL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE 3915214..3962320 47106


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15471.88 Da        Isoelectric Point: 8.0949

>T253366 WP_001521903.1 NZ_CP102244:c3962024-3961626 [Escherichia coli O7:H15]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.76 Da        Isoelectric Point: 5.2170

>AT253366 WP_000554758.1 NZ_CP102244:c3962320-3962027 [Escherichia coli O7:H15]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D8WHS4

Antitoxin

Source ID Structure
AlphaFold DB S1QAE3

References